Germany
Japan
United Kingdom
China
USD 420.00
In Stock
ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 420.00
In Stock
ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 823.00
In Stock
Recombinant protein of human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, ACP5 (Myc-DDK tagged) - Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, ACP5 (mGFP-tagged) - Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 460.00
In Stock
ACP5 (GFP-tagged) - Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
In Stock
ACP5 (GFP-tagged) - Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 620.00
3 Weeks
Lenti ORF clone of Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, ACP5 (Myc-DDK tagged) - Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, ACP5 (mGFP-tagged) - Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Tartrate Resistant Acid Phosphatase (ACP5) (NM_001111034) Human Tagged ORF Clone Lentiviral Particle
USD 820.00
6 Weeks
Lenti ORF particles, ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of ACP5 (mGFP-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Tartrate Resistant Acid Phosphatase (ACP5) (NM_001111034) Human Tagged ORF Clone Lentiviral Particle
USD 820.00
6 Weeks
Lenti ORF particles, ACP5 (mGFP-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Tartrate Resistant Acid Phosphatase (ACP5) (NM_001111035) Human Tagged ORF Clone Lentiviral Particle
USD 820.00
6 Weeks
Lenti ORF particles, ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of ACP5 (mGFP-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Tartrate Resistant Acid Phosphatase (ACP5) (NM_001111035) Human Tagged ORF Clone Lentiviral Particle
USD 820.00
6 Weeks
Lenti ORF particles, ACP5 (mGFP-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Tartrate Resistant Acid Phosphatase (ACP5) (NM_001111036) Human Tagged ORF Clone Lentiviral Particle
USD 820.00
6 Weeks
Lenti ORF particles, ACP5 (Myc-DDK-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of ACP5 (mGFP-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Tartrate Resistant Acid Phosphatase (ACP5) (NM_001111036) Human Tagged ORF Clone Lentiviral Particle
USD 820.00
6 Weeks
Lenti ORF particles, ACP5 (mGFP-tagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 460.00
3 Weeks
ACP5 (GFP-tagged) - Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
3 Weeks
ACP5 (GFP-tagged) - Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 768.00
In Stock
Lenti ORF clone of Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-ACP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP5 antibody: synthetic peptide directed towards the N terminal of human ACP5. Synthetic peptide located within the following region: DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ |
USD 121.00
In Stock
ACP5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
In Stock
ACP5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 121.00
In Stock
ACP5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 310.00
In Stock
ACP5 (untagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 265.00
5 Days
Mouse Monoclonal anti-tartrate-resistant acid phosphatase (TRAcP) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 396.00
5 Days
Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
2 Weeks
ACP5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 396.00
5 Days
Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 396.00
5 Days
Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 2,055.00
3 Weeks
ACP5 MS Standard C13 and N15-labeled recombinant protein (NP_001602)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 660.00
3 Weeks
ACP5 (untagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 660.00
3 Weeks
ACP5 (untagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
USD 660.00
4 Weeks
ACP5 (untagged)-Human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of ACP5 (NM_001611) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACP5 (NM_001111034) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACP5 (NM_001111035) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACP5 (NM_001111036) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- ACP5
Pathways
- Lysosome