CTSK (Myc-DDK-tagged)-Human cathepsin K (CTSK)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTSK (Myc-DDK-tagged)-Human cathepsin K (CTSK)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, CTSK (Myc-DDK tagged) - Human cathepsin K (CTSK), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CTSK (mGFP-tagged) - Human cathepsin K (CTSK), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CTSK (GFP-tagged) - Human cathepsin K (CTSK)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cathepsin K (CTSK), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, CTSK (Myc-DDK tagged) - Human cathepsin K (CTSK), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, CTSK (mGFP-tagged) - Human cathepsin K (CTSK), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CTSK (untagged)-Human cathepsin K (CTSK)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cathepsin K (CTSK), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Cathepsin K Rabbit anti-Rat Polyclonal Antibody
Applications | IHC |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K. |
Transient overexpression lysate of cathepsin K (CTSK)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Cathepsin K Rabbit anti-Rat Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K. |
Cathepsin K (CTSK) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Human, Monkey, Porcine, Rabbit |
Immunogen | KLH conjugated synthetic peptide between aa 207-27 from the Center region of human CTSK. |
Cathepsin K (CTSK) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 96-126 amino acids from the Central region of Human Cathepsin K |
CTSK HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human cathepsin K (CTSK), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CTSK (untagged)-Human cathepsin K (CTSK)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Goat Polyclonal Antibody against CTSK
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KTHRKQYNNKVDE, from the internal region (near N-terminus) of the protein sequence according to NP_000387.1. |
Rabbit Polyclonal Anti-CTSK Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTSK antibody: synthetic peptide directed towards the middle region of human CTSK. Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY |
Rabbit Polyclonal Anti-CTSK Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CTSK |
Transient overexpression of CTSK (NM_000396) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CTSK (NM_000396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CTSK (NM_000396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack