Products

Antibodies (29)
cDNA Clones (20)
Proteins (10)
Jump to Filters
View as table Download
ATF 4 (ATF4) (NM_001675) Human Untagged Clone
SC119103

USD 310.00

In Stock

ATF4 (untagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ATF 4 (ATF4) (NM_001675) Human Recombinant Protein
TP760367

USD 215.00

In Stock

Purified recombinant protein of Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
ATF 4 (ATF4) (NM_001675) Human Tagged ORF Clone
RG222709

USD 460.00

In Stock

ATF4 (GFP-tagged) - Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATF 4 (ATF4) (NM_001675) Human Tagged ORF Clone
RC222709

USD 420.00

In Stock

ATF4 (Myc-DDK-tagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATF 4 (ATF4) (NM_182810) Human Tagged ORF Clone Lentiviral Particle
RC202333L1V

USD 820.00

3 Weeks

Lenti ORF particles, ATF4 (Myc-DDK tagged) - Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ATF 4 (ATF4) (NM_182810) Human Tagged ORF Clone Lentiviral Particle
RC202333L2V

USD 820.00

6 Weeks

Lenti ORF particles, ATF4 (mGFP-tagged) - Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ATF 4 (ATF4) (NM_001675) Human Tagged ORF Clone Lentiviral Particle
RC222709L1V

USD 820.00

3 Weeks

Lenti ORF particles, ATF4 (Myc-DDK-tagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ATF 4 (ATF4) (NM_001675) Human Tagged ORF Clone Lentiviral Particle
RC222709L2V

USD 820.00

3 Weeks

Lenti ORF particles, ATF4 (mGFP-tagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ATF 4 (ATF4) (NM_182810) Human Tagged ORF Clone
RC202333

USD 420.00

In Stock

ATF4 (Myc-DDK-tagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATF 4 (ATF4) (NM_182810) Human Tagged ORF Clone
RG202333

USD 460.00

In Stock

ATF4 (GFP-tagged) - Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATF 4 (ATF4) (NM_182810) Human Tagged ORF Clone
RC202333L3

USD 620.00

3 Weeks

Lenti ORF clone of Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATF 4 (ATF4) (NM_182810) Human Tagged ORF Clone Lentiviral Particle
RC202333L3V

USD 820.00

5 Weeks

Lenti ORF particles, ATF4 (Myc-DDK tagged) - Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATF 4 (ATF4) (NM_182810) Human Tagged ORF Clone
RC202333L4

USD 620.00

3 Weeks

Lenti ORF clone of Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATF 4 (ATF4) (NM_182810) Human Tagged ORF Clone Lentiviral Particle
RC202333L4V

USD 820.00

7 Weeks

Lenti ORF particles, ATF4 (mGFP-tagged) - Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATF 4 (ATF4) (NM_001675) Human Tagged ORF Clone Lentiviral Particle
RC222709L3V

USD 820.00

11 Weeks

Lenti ORF particles, ATF4 (Myc-DDK-tagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATF 4 (ATF4) (NM_001675) Human Tagged ORF Clone
RC222709L4

USD 620.00

2 Weeks

Lenti-ORF clone of ATF4 (mGFP-tagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATF 4 (ATF4) (NM_001675) Human Tagged ORF Clone Lentiviral Particle
RC222709L4V

USD 820.00

5 Weeks

Lenti ORF particles, ATF4 (mGFP-tagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA349254

USD 380.00

In Stock

Rabbit Polyclonal Anti-ATF4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATF4
ATF 4 (ATF4) (NM_182810) Human Untagged Clone
SC127457

USD 310.00

In Stock

ATF4 (untagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ATF 4 (ATF4) (NM_001675) Human Tagged ORF Clone
RC222709L2

USD 768.00

In Stock

Lenti-ORF clone of ATF4 (mGFP-tagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ATF 4 (ATF4) (NM_182810) Human Untagged Clone
SC322421

USD 310.00

In Stock

ATF4 (untagged)-Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA326766

USD 275.00

2 Weeks

ATF4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ATF4
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA341834

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-Atf4 Antibody

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Atf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVR
ATF 4 (ATF4) Goat Polyclonal Antibody
TA302638

USD 375.00

In Stock

Goat Polyclonal Antibody against ATF4

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEVRKARGKKRVP, from the C Terminus of the protein sequence according to NP_001666.
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA326046

USD 345.00

In Stock

Rabbit polyclonal ATF-4 (Phospho-Ser219) antibody

Applications WB
Reactivities H:S219, M:S218
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ATF-4.
Modifications Phospho-specific
ATF 4 (ATF4) Rabbit Polyclonal Antibody
AP31750PU-N

USD 440.00

2 Weeks

ATF 4 (ATF4) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide.
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA302232

USD 450.00

In Stock

Rabbit Polyclonal Antibody against ATF4 (S245)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 220-252 amino acids from human ATF4.
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA309962

USD 370.00

In Stock

Rabbit anti-ATF4 (Phospho-Ser245) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanATF4 around the phosphorylation site of serine 245 (N-R-SP-L-P).
Modifications Phospho-specific
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA590092

USD 409.00

In Stock

Rabbit Polyclonal ATF4 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the Middle Region
ATF 4 (ATF4) (NM_182810) Human Tagged ORF Clone
RC202333L2

USD 620.00

3 Weeks

Lenti ORF clone of Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA313483

USD 345.00

In Stock

Rabbit polyclonal ATF4(Ab-245) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human ATF4 around the phosphorylation site of Serine 245.
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA326209

USD 345.00

In Stock

Rabbit polyclonal ATF-4 (Ab-219) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ATF4.
ATF 4 (ATF4) (NM_182810) Human Recombinant Protein
TP760908

USD 215.00

In Stock

Purified recombinant protein of Human activating transcription factor 4 (tax-responsive enhancer element B67) (ATF4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA324485

USD 450.00

5 Days

Rabbit polyclonal ATF4 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 171-198 amino acids from the Central region of human ATF4.
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA330131

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the middle region of human ATF4. Synthetic peptide located within the following region: LGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGS
ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA335204

USD 310.00

5 Days

Rabbit Polyclonal Anti-ATF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the C terminal of human ATF4. Synthetic peptide located within the following region: EQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLK
ATF4 (1-351, His-Cam-tag) Human Protein
AR39078PU-L

USD 1,105.00

2 Weeks

ATF4 (1-351, His-Cam-tag) human recombinant protein, 0.25 mg

Tag His-Cam-tag
Expression Host E. coli
ATF4 (1-351, His-Cam-tag) Human Protein
AR39078PU-N

USD 415.00

2 Weeks

ATF4 (1-351, His-Cam-tag) human recombinant protein, 50 µg

Tag His-Cam-tag
Expression Host E. coli
ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI1H9]
CF812797

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ATF4 mouse monoclonal antibody, clone OTI1H9

Applications WB
Reactivities Human
Conjugation Unconjugated
ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI5F5]
CF812802

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ATF4 mouse monoclonal antibody, clone OTI5F5

Applications WB
Reactivities Human
Conjugation Unconjugated
ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI8F5]
CF812805

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ATF4 mouse monoclonal antibody, clone OTI8F5

Applications WB
Reactivities Human
Conjugation Unconjugated
ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI1H9]
TA812797

USD 379.00

In Stock

ATF4 mouse monoclonal antibody, clone OTI1H9

Applications WB
Reactivities Human
Conjugation Unconjugated
ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI1H9]
TA812797S

USD 159.00

2 Days

ATF4 mouse monoclonal antibody, clone OTI1H9

Applications WB
Reactivities Human
Conjugation Unconjugated
ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI5F5]
TA812802

USD 379.00

In Stock

ATF4 mouse monoclonal antibody, clone OTI5F5

Applications WB
Reactivities Human
Conjugation Unconjugated
ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI5F5]
TA812802S

USD 159.00

2 Days

ATF4 mouse monoclonal antibody, clone OTI5F5

Applications WB
Reactivities Human
Conjugation Unconjugated
ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI8F5]
TA812805

USD 379.00

In Stock

ATF4 mouse monoclonal antibody, clone OTI8F5

Applications WB
Reactivities Human
Conjugation Unconjugated