Products

View as table Download

CACNB1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CACNB1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CACNB1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CACNB1 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNB1 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CACNB1 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNB1 (untagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CACNB1

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CACNB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CACNB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CACNB1 (untagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP

CACNB1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 542-572 amino acids from the C-terminal region of human CACNB1

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: DWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSS

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the C terminal of human CACNB1. Synthetic peptide located within the following region: RTMATAALAASPAPVSNLQVQVLTSLRRNLGFWGGLESSQRGSVVPQEQE

Carrier-free (BSA/glycerol-free) CACNB1 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

CACNB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CACNB1 MS Standard C13 and N15-labeled recombinant protein (NP_000714)

Tag C-Myc/DDK
Expression Host HEK293

CACNB1 MS Standard C13 and N15-labeled recombinant protein (NP_954855)

Tag C-Myc/DDK
Expression Host HEK293

CACNB1 (untagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

CACNB1 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

CACNB1 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated