MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MAP4K4 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MAP4K4 (mGFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti-ORF clone of MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
MAP4K4 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MAP4K4 (Myc-DDK tagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAP4K4 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAP4K4 (mGFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MAP4K4 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAP4K4 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MAP4K4 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAP4K4 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAP4K4 (Myc-DDK tagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAP4K4 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MAP4K4 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MAP4K4 (GFP-tagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MAP4K4 (GFP-tagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
MAP4K4 (untagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MAP4K4 (untagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-MEKKK 4 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MEKKK 4. |
Rabbit Polyclonal Anti-MEKKK 4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MEKKK 4 Antibody: A synthesized peptide derived from human MEKKK 4 |
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MAP4K4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse |
MAP4K4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal Anti-MAP4K4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP4K4 antibody: synthetic peptide directed towards the N terminal of human MAP4K4. Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ |
MAP4K4 (untagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
MAP4K4 (untagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
MAP4K4 (untagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of MAP4K4 (NM_145686) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP4K4 (NM_004834) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP4K4 (NM_145687) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP4K4 (NM_001242560) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP4K4 (NM_001242559) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP4K4 (NM_145686) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAP4K4 (NM_145686) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAP4K4 (NM_004834) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAP4K4 (NM_145687) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAP4K4 (NM_001242560) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAP4K4 (NM_001242560) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAP4K4 (NM_001242559) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack