Products

cDNA Clones (31)
Proteins (14)
Antibodies (4)
Jump to Filters
View as table Download
MAP4K4 (NM_145686) Human Tagged ORF Clone
RC215163

USD 1,390.00

In Stock

MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MAP4K4 (NM_145686) Human Tagged ORF Clone Lentiviral Particle
RC215163L1V

USD 1,790.00

3 Weeks

Lenti ORF particles, MAP4K4 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MAP4K4 (NM_145686) Human Tagged ORF Clone Lentiviral Particle
RC215163L2V

USD 1,790.00

6 Weeks

Lenti ORF particles, MAP4K4 (mGFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MAP4K4 (NM_145687) Human Tagged ORF Clone
RC219603L3

USD 1,470.00

In Stock

Lenti-ORF clone of MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_145686) Human Tagged ORF Clone
RG215163

USD 1,530.00

In Stock

MAP4K4 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MAP4K4 (NM_001242560) Human Tagged ORF Clone
RC235232

USD 1,300.00

2 Weeks

MAP4K4 (Myc-DDK tagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MAP4K4 (NM_145686) Human Tagged ORF Clone
RC215163L3

USD 1,590.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_145686) Human Tagged ORF Clone Lentiviral Particle
RC215163L3V

USD 1,790.00

5 Weeks

Lenti ORF particles, MAP4K4 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_145686) Human Tagged ORF Clone
RC215163L4

USD 1,590.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_145686) Human Tagged ORF Clone Lentiviral Particle
RC215163L4V

USD 1,790.00

7 Weeks

Lenti ORF particles, MAP4K4 (mGFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_004834) Human Tagged ORF Clone
RC219540

USD 1,220.00

5 Weeks

MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MAP4K4 (NM_004834) Human Tagged ORF Clone
RC219540L3

USD 1,420.00

5 Weeks

Lenti-ORF clone of MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_004834) Human Tagged ORF Clone Lentiviral Particle
RC219540L3V

USD 1,620.00

8 Weeks

Lenti ORF particles, MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_004834) Human Tagged ORF Clone
RC219540L4

USD 1,420.00

5 Weeks

Lenti-ORF clone of MAP4K4 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_004834) Human Tagged ORF Clone Lentiviral Particle
RC219540L4V

USD 1,620.00

8 Weeks

Lenti ORF particles, MAP4K4 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_145687) Human Tagged ORF Clone
RC219603

USD 1,270.00

3 Weeks

MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MAP4K4 (NM_145687) Human Tagged ORF Clone Lentiviral Particle
RC219603L3V

USD 1,670.00

3 Weeks

Lenti ORF particles, MAP4K4 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_145687) Human Tagged ORF Clone
RC219603L4

USD 1,470.00

3 Weeks

Lenti-ORF clone of MAP4K4 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_145687) Human Tagged ORF Clone Lentiviral Particle
RC219603L4V

USD 1,670.00

9 Weeks

Lenti ORF particles, MAP4K4 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MAP4K4 (NM_001242559) Human Tagged ORF Clone
RC235235

USD 1,300.00

8 Weeks

MAP4K4 (Myc-DDK tagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MAP4K4 (NM_004834) Human Tagged ORF Clone
RG219540

USD 1,340.00

7 Weeks

MAP4K4 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MAP4K4 (NM_145687) Human Tagged ORF Clone
RG219603

USD 1,400.00

3 Weeks

MAP4K4 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MAP4K4 (NM_001242560) Human Tagged ORF Clone
RG235232

USD 1,430.00

8 Weeks

MAP4K4 (GFP-tagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MAP4K4 (NM_001242559) Human Tagged ORF Clone
RG235235

USD 1,430.00

8 Weeks

MAP4K4 (GFP-tagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MAP4K4 (NM_145686) Human Tagged Lenti ORF Clone
RC215163L1

USD 1,968.00

In Stock

Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MAP4K4 (NM_004834) Human Untagged Clone
SC309964

USD 2,360.00

In Stock

MAP4K4 (untagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC309964 is the updated version of SC124223.
MAP4K4 (NM_145686) Human Over-expression Lysate
LY407892

USD 605.00

5 Days

Transient overexpression lysate of mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MAP4K4 (NM_145686) Human Untagged Clone
SC100241

USD 2,680.00

2 Weeks

MAP4K4 (untagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
MAP4K4 Rabbit Polyclonal Antibody
TA314915

USD 345.00

In Stock

Rabbit polyclonal anti-MEKKK 4 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MEKKK 4.
MAP4K4 Rabbit Polyclonal Antibody
TA347637

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MEKKK 4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MEKKK 4 Antibody: A synthesized peptide derived from human MEKKK 4
MAP4K4 (NM_145686) Human Tagged ORF Clone
RC215163L2

USD 1,590.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MAP4K4 Rabbit Polyclonal Antibody
AP20403PU-N

USD 370.00

2 Weeks

MAP4K4 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
MAP4K4 (NM_145686) Human Over-expression Lysate
LC407892

USD 187.00

In Stock

MAP4K4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MAP4K4 Rabbit Polyclonal Antibody
TA330965

USD 375.00

5 Days

Rabbit polyclonal Anti-MAP4K4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP4K4 antibody: synthetic peptide directed towards the N terminal of human MAP4K4. Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ
MAP4K4 (NM_145687) Human Untagged Clone
SC309948

USD 2,460.00

7 Weeks

MAP4K4 (untagged)-Human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 3

Vector pCMV6 series
Tag Tag Free
SC309948 is the updated version of SC110056.
MAP4K4 (NM_001242559) Human Untagged Clone
SC331827

USD 1,260.00

8 Weeks

MAP4K4 (untagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 4

Vector pCMV6 series
Tag Tag Free
MAP4K4 (NM_001242560) Human Untagged Clone
SC331828

USD 1,250.00

8 Weeks

MAP4K4 (untagged) - Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 5

Vector pCMV6 series
Tag Tag Free
MAP4K4 (NM_145686) ICC Control Block
TB415163

USD 2,040.00

4 Weeks

Transient overexpression of MAP4K4 (NM_145686) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MAP4K4 (NM_004834) ICC Control Block
TB419540

USD 1,870.00

4 Weeks

Transient overexpression of MAP4K4 (NM_004834) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MAP4K4 (NM_145687) ICC Control Block
TB419603

USD 1,920.00

4 Weeks

Transient overexpression of MAP4K4 (NM_145687) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MAP4K4 (NM_001242560) ICC Control Block
TB435232

USD 1,950.00

4 Weeks

Transient overexpression of MAP4K4 (NM_001242560) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MAP4K4 (NM_001242559) ICC Control Block
TB435235

USD 1,950.00

4 Weeks

Transient overexpression of MAP4K4 (NM_001242559) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MAP4K4 Cytosection
TS415163

USD 225.00

4 Weeks

Transient overexpression of MAP4K4 (NM_145686) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MAP4K4 Cytosection
TS415163P5

USD 889.00

4 Weeks

Transient overexpression of MAP4K4 (NM_145686) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

MAP4K4 ICC Control Sections
TS419540P5

USD 889.00

4 Weeks

Transient overexpression of MAP4K4 (NM_004834) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

MAP4K4 ICC Control Sections
TS419603P5

USD 889.00

4 Weeks

Transient overexpression of MAP4K4 (NM_145687) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

MAP4K4 Cytosection
TS435232

USD 225.00

10 Weeks

Transient overexpression of MAP4K4 (NM_001242560) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MAP4K4 Cytosection
TS435232P5

USD 889.00

4 Weeks

Transient overexpression of MAP4K4 (NM_001242560) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

MAP4K4 ICC Control Sections
TS435235P5

USD 889.00

4 Weeks

Transient overexpression of MAP4K4 (NM_001242559) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack