Germany
Japan
United Kingdom
China
RELB (Myc-DDK-tagged)-Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
RELB (GFP-tagged) - Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RELB (untagged)-Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB)
| Vector | PCMV6-Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human v-rel reticuloendotheliosis viral oncogene homolog B (RELB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, RELB (Myc-DDK tagged) - Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, RELB (mGFP-tagged) - Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RELB (Myc-DDK tagged) - Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RELB (mGFP-tagged) - Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RELB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of human RELB. Synthetic peptide located within the following region: DLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASL |
Lenti ORF clone of Human v-rel reticuloendotheliosis viral oncogene homolog B (RELB), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal RelB (Ser552) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human RelB around the phosphorylation site of Serine 552 |
| Modifications | Phospho-specific |
Transient overexpression lysate of v-rel reticuloendotheliosis viral oncogene homolog B (RELB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal RelB (Ser552) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RelB around the phosphorylation site of serine 552 (L-L-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal RelB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human RelB |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of human RELB. Synthetic peptide located within the following region: FTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDH |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RELB Antibody: synthetic peptide directed towards the C terminal of human RELB. Synthetic peptide located within the following region: GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of mouse RELB. Synthetic peptide located within the following region: FLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHG |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RELB antibody: synthetic peptide directed towards the N terminal of human RELB. Synthetic peptide located within the following region: LRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRST |
RELB MS Standard C13 and N15-labeled recombinant protein (NP_006500)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-RELB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RELB |
RELB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of RELB (NM_006509) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RELB (NM_006509) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RELB (NM_006509) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RELB
Pathways
- MAPK signaling pathway