Products

cDNA Clones (29)
Proteins (15)
Antibodies (4)
Jump to Filters
View as table Download
RRAS2 (NM_012250) Human Tagged ORF Clone
RC204591

USD 118.00

USD 429.00

In Stock

RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RRAS2 (NM_012250) Human Tagged ORF Clone Lentiviral Particle
RC204591L3V

USD 1,020.00

6 Weeks

Lenti ORF particles, RRAS2 (Myc-DDK tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_012250) Human Tagged ORF Clone Lentiviral Particle
RC204591L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, RRAS2 (mGFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_012250) Human Recombinant Protein
TP304591

USD 823.00

In Stock

Recombinant protein of human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
RRAS2 (NM_012250) Human Tagged ORF Clone
RG204591

USD 460.00

In Stock

RRAS2 (GFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone
RC220668

USD 420.00

2 Weeks

RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone
RC220668L3

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone Lentiviral Particle
RC220668L3V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone
RC220668L4

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone Lentiviral Particle
RC220668L4V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone
RC229556

USD 420.00

2 Weeks

RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone
RC229556L3

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone Lentiviral Particle
RC229556L3V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone
RC229556L4

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone Lentiviral Particle
RC229556L4V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone
RC229627

USD 420.00

2 Weeks

RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone
RC229627L3

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone Lentiviral Particle
RC229627L3V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone
RC229627L4

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone Lentiviral Particle
RC229627L4V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone
RG220668

USD 460.00

3 Weeks

RRAS2 (GFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone
RG229556

USD 460.00

3 Weeks

RRAS2 (GFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone
RG229627

USD 460.00

3 Weeks

RRAS2 (GFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_012250) Human Tagged Lenti ORF Clone
RC204591L4

USD 768.00

In Stock

Lenti ORF clone of Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_012250) Human Untagged Clone
SC115460

USD 310.00

In Stock

RRAS2 (untagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RRAS2 (NM_012250) Human Untagged Clone
SC322652

USD 310.00

In Stock

RRAS2 (untagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RRAS2 (NM_012250) Human Tagged ORF Clone
RC204591L3

USD 768.00

3 Weeks

Lenti ORF clone of Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_012250) Human Over-expression Lysate
LC415877

USD 121.00

In Stock

RRAS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RRAS2 Rabbit Polyclonal Antibody
TA308124

USD 415.00

5 Days

Rabbit Polyclonal antibody to TC21 (related RAS viral (r-ras) oncogene homolog 2)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 204 of TC21 (Uniprot ID#P62070)
RRAS2 Rabbit Polyclonal Antibody
TA319836

USD 430.00

5 Days

Rabbit Polyclonal RRAS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Rabbit polyclonal RRAS2 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human RRAS2.
RRAS2 Rabbit Polyclonal Antibody
TA334999

USD 375.00

5 Days

Rabbit Polyclonal Anti-RRAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RRAS2 antibody is: synthetic peptide directed towards the C-terminal region of Human RRAS2. Synthetic peptide located within the following region: EASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
RRAS2 / TC21 (1-201, His-tag) Human Protein
AR09279PU-L

USD 620.00

2 Weeks

RRAS2 / TC21 (1-201, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
RRAS2 / TC21 (1-201, His-tag) Human Protein
AR09279PU-N

USD 260.00

2 Weeks

RRAS2 / TC21 (1-201, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
RRAS2 (NM_012250) Human Mass Spec Standard
PH304591

USD 2,055.00

3 Weeks

RRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_036382)

Tag C-Myc/DDK
Expression Host HEK293
RRAS2 (NM_001102669) Human Untagged Clone
SC316896

USD 420.00

2 Weeks

RRAS2 (untagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2

Vector pCMV6 series
Tag Tag Free
RRAS2 (NM_001177315) Human Untagged Clone
SC328194

USD 420.00

2 Weeks

RRAS2 (untagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2) transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RRAS2 (NM_001177314) Human Untagged Clone
SC328265

USD 420.00

2 Weeks

RRAS2 (untagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RRAS2 Rabbit Polyclonal Antibody
TA350377

USD 345.00

In Stock

Rabbit Polyclonal Anti-RRAS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RRAS2
RRAS2 (NM_012250) ICC Control Block
TB404591

USD 1,040.00

4 Weeks

Transient overexpression of RRAS2 (NM_012250) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RRAS2 (NM_001102669) ICC Control Block
TB420668

USD 1,070.00

4 Weeks

Transient overexpression of RRAS2 (NM_001102669) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RRAS2 (NM_001177315) ICC Control Block
TB429556

USD 1,070.00

4 Weeks

Transient overexpression of RRAS2 (NM_001177315) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RRAS2 (NM_001177314) ICC Control Block
TB429627

USD 1,070.00

4 Weeks

Transient overexpression of RRAS2 (NM_001177314) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RRAS2 Cytosection
TS404591

USD 225.00

4 Weeks

Transient overexpression of RRAS2 (NM_012250) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RRAS2 Cytosection
TS404591P5

USD 889.00

4 Weeks

Transient overexpression of RRAS2 (NM_012250) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RRAS2 ICC Control Sections
TS420668P5

USD 889.00

4 Weeks

Transient overexpression of RRAS2 (NM_001102669) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RRAS2 ICC Control Sections
TS429556P5

USD 889.00

4 Weeks

Transient overexpression of RRAS2 (NM_001177315) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RRAS2 ICC Control Sections
TS429627P5

USD 889.00

4 Weeks

Transient overexpression of RRAS2 (NM_001177314) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack