Products

View as table Download

TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human mitogen-activated protein kinase kinase kinase 7 interacting protein 1 (MAP3K7IP1), transcript variant alpha

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, TAB1 (Myc-DDK tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, TAB1 (mGFP-tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

TAB1 (GFP-tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, TAB1 (Myc-DDK tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, TAB1 (mGFP-tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of TAB1 (mGFP-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, TAB1 (mGFP-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

TAB1 (GFP-tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TAB1 (untagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

TAB1 (untagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit anti-MAP3K7IP1 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant Protein of human MAP3K7IP1

Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 interacting protein 1 (MAP3K7IP1), transcript variant alpha

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

TAB1 (untagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Mouse Monoclonal TAB1(N-terminus) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TAB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TAB1

Lenti ORF clone of Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

TAB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

TAB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 interacting protein 1 (MAP3K7IP1), transcript variant beta

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Rabbit Polyclonal TAB1 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TAB1 antibody was raised against a synthetic peptide corresponding to 13 amino acids in the center of human TAB1.

TAB1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the amino acid residues surrounding S423 of human MAP3K7IP1

Rabbit Polyclonal Anti-TAB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAB1 antibody: synthetic peptide directed towards the N terminal of human TAB1. Synthetic peptide located within the following region: MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE

TAB1 MS Standard C13 and N15-labeled recombinant protein (NP_006107)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-TAB1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TAB1

Transient overexpression of TAB1 (NM_006116) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TAB1 (NM_153497) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of TAB1 (NM_006116) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TAB1 (NM_006116) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of TAB1 (NM_153497) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TAB1 (NM_153497) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack