TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human mitogen-activated protein kinase kinase kinase 7 interacting protein 1 (MAP3K7IP1), transcript variant alpha
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF particles, TAB1 (Myc-DDK tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, TAB1 (mGFP-tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
TAB1 (GFP-tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, TAB1 (Myc-DDK tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TAB1 (mGFP-tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TAB1 (mGFP-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TAB1 (mGFP-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TAB1 (GFP-tagged) - Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TAB1 (untagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
TAB1 (untagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant beta
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit anti-MAP3K7IP1 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human MAP3K7IP1 |
Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 interacting protein 1 (MAP3K7IP1), transcript variant alpha
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
TAB1 (untagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Mouse Monoclonal TAB1(N-terminus) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TAB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TAB1 |
Lenti ORF clone of Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
TAB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TAB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 interacting protein 1 (MAP3K7IP1), transcript variant beta
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal TAB1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TAB1 antibody was raised against a synthetic peptide corresponding to 13 amino acids in the center of human TAB1. |
TAB1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the amino acid residues surrounding S423 of human MAP3K7IP1 |
Rabbit Polyclonal Anti-TAB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAB1 antibody: synthetic peptide directed towards the N terminal of human TAB1. Synthetic peptide located within the following region: MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE |
TAB1 MS Standard C13 and N15-labeled recombinant protein (NP_006107)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-TAB1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TAB1 |
Transient overexpression of TAB1 (NM_006116) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAB1 (NM_153497) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAB1 (NM_006116) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TAB1 (NM_006116) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TAB1 (NM_153497) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TAB1 (NM_153497) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack