Products

cDNA Clones (16)
Antibodies (13)
Proteins (12)
Jump to Filters
View as table Download
HNF1 beta (HNF1B) (NM_001165923) Human Tagged ORF Clone
RC228433

USD 490.00

In Stock

HNF1B (Myc-DDK-tagged)-Human HNF1 homeobox B (HNF1B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HNF1 beta (HNF1B) (NM_000458) Human Tagged ORF Clone
RG204453

USD 530.00

In Stock

HNF1B (GFP-tagged) - Human HNF1 homeobox B (HNF1B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HNF1 beta (HNF1B) (NM_000458) Human Untagged Clone
SC122562

USD 310.00

In Stock

HNF1B (untagged)-Human HNF1 homeobox B (HNF1B), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HNF1 beta (HNF1B) (NM_000458) Human Tagged ORF Clone
RC204453L3

USD 680.00

3 Weeks

Lenti ORF clone of Human HNF1 homeobox B (HNF1B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNF1 beta (HNF1B) (NM_001165923) Human Tagged ORF Clone Lentiviral Particle
RC228433L3V

USD 890.00

6 Weeks

Lenti ORF particles, HNF1B (Myc-DDK tagged) - Human HNF1 homeobox B (HNF1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNF1 beta (HNF1B) (NM_001165923) Human Tagged ORF Clone
RC228433L4

USD 690.00

3 Weeks

Lenti ORF clone of Human HNF1 homeobox B (HNF1B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HNF1 beta (HNF1B) (NM_001165923) Human Tagged ORF Clone
RG228433

USD 540.00

3 Weeks

HNF1B (GFP-tagged) - Human HNF1 homeobox B (HNF1B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HNF1 beta (HNF1B) (NM_000458) Human Over-expression Lysate
LY400162

USD 396.00

5 Days

Transient overexpression lysate of HNF1 homeobox B (HNF1B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA347848

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-HNF-1β(TCF-2) Antibody 

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF-1β(TCF-2) Antibody: Peptide sequence around aa.252~256(R-Q-K-N-P) derived from Human HNF-1b(TCF-2).
HNF1 beta (HNF1B) Goat Polyclonal Antibody
TA302622

USD 375.00

In Stock

Goat Polyclonal Antibody against TCF2 / VHNF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1.
HNF1 beta (HNF1B) (NM_000458) Human Over-expression Lysate
LC400162

USD 121.00

In Stock

HNF1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
HNF1 beta (HNF1B) (C-term) Rabbit Polyclonal Antibody
AP52066PU-N

USD 450.00

2 Weeks

HNF1 beta (HNF1B) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 505-536 amino acids from the C-terminal region of human HNF1B
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA330246

USD 375.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA330247

USD 310.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA332360

USD 375.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HNF1B Antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: NFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYD
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA334721

USD 375.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the C terminal of human HNF1B. Synthetic peptide located within the following region: QGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMIS
HNF1 beta (HNF1B) (NM_001165923) Human Over-expression Lysate
LC431461

USD 121.00

2 Weeks

HNF1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HNF1 beta (HNF1B) (NM_001165923) Human Over-expression Lysate
LY431461

USD 396.00

5 Days

Transient overexpression lysate of HNF1 homeobox B (HNF1B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HNF1 beta (HNF1B) (NM_000458) Human Mass Spec Standard
PH304453

USD 2,055.00

3 Weeks

HNF1B MS Standard C13 and N15-labeled recombinant protein (NP_000449)

Tag C-Myc/DDK
Expression Host HEK293
HNF1 beta (HNF1B) (NM_001165923) Human Untagged Clone
SC327068

USD 900.00

3 Weeks

HNF1B (untagged)-Human HNF1 homeobox B (HNF1B) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA321135

USD 345.00

In Stock

Anti-HNF1B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human HNF1 homeobox B
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA321136

USD 345.00

In Stock

Anti-HNF1B Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human HNF1 homeobox B
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA890005

USD 345.00

In Stock

Rabbit polyclonal HNF1B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B.
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA890005S

USD 159.00

In Stock

Rabbit polyclonal HNF1B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B.
HNF1 beta (HNF1B) ICC Control Block
TB404453

USD 1,130.00

4 Weeks

Transient overexpression of HNF1B (NM_000458) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HNF1 beta (HNF1B) ICC Control Block
TB428433

USD 1,140.00

4 Weeks

Transient overexpression of HNF1B (NM_001165923) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HNF1 beta (HNF1B) Cytosection
TS404453

USD 225.00

4 Weeks

Transient overexpression of HNF1B (NM_000458) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HNF1 beta (HNF1B) Cytosection
TS404453P5

USD 889.00

4 Weeks

Transient overexpression of HNF1B (NM_000458) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HNF1 beta (HNF1B) Cytosection
TS428433

USD 225.00

4 Weeks

Transient overexpression of HNF1B (NM_001165923) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HNF1 beta (HNF1B) Cytosection
TS428433P5

USD 889.00

4 Weeks

Transient overexpression of HNF1B (NM_001165923) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack