AASDHPPT (Myc-DDK-tagged)-Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AASDHPPT (Myc-DDK-tagged)-Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AASDHPPT (Myc-DDK tagged) - Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AASDHPPT (mGFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AASDHPPT (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-AASDHPPT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AASDHPPT antibody: synthetic peptide directed towards the C terminal of human AASDHPPT. Synthetic peptide located within the following region: SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE |
Rabbit polyclonal anti-AASDHPPT antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AASDHPPT. |
AASDHPPT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AASDHPPT (untagged)-Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
AASDHPPT (untagged)-Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
AASDHPPT (14-309, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
AASDHPPT (14-309, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
AASDHPPT MS Standard C13 and N15-labeled recombinant protein (NP_056238)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-AASDHPPT Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-AASDHPPT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Transient overexpression of AASDHPPT (NM_015423) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AASDHPPT (NM_015423) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AASDHPPT (NM_015423) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack