ACAD8 (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ACAD8 (Myc-DDK-tagged)-Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human acyl-Coenzyme A dehydrogenase family, member 8 (ACAD8)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
ACAD8 (GFP-tagged) - Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ACAD8 (Myc-DDK tagged) - Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ACAD8 (mGFP-tagged) - Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ACAD8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of acyl-Coenzyme A dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ACAD8 (untagged)-Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ACAD8 (untagged)-Human acyl-CoA dehydrogenase family, member 8 (ACAD8), nuclear gene encoding mitochondrial protein
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal antibody to ACAD8 (acyl-Coenzyme A dehydrogenase family, member 8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 415 of ACAD8 (Uniprot ID#Q9UKU7) |
Rabbit Polyclonal Anti-ACAD8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACAD8 antibody is: synthetic peptide directed towards the N-terminal region of Human ACAD8. Synthetic peptide located within the following region: KFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVV |
ACAD8 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 125~154 amino acids from the Central region of human ACAD8 |
ACAD8 (23-415, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
ACAD8 (23-415, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
ACAD8 MS Standard C13 and N15-labeled recombinant protein (NP_055199)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-ACAD8 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase family, member 8 |
Anti-ACAD8 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase family, member 8 |
Transient overexpression of ACAD8 (NM_014384) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACAD8 (NM_014384) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACAD8 (NM_014384) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack