Products

View as table Download

AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, AMT (Myc-DDK tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, AMT (mGFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AMT (Myc-DDK tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AMT (mGFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AMT (Myc-DDK tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AMT (mGFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of AMT (mGFP-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AMT (mGFP-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of AMT (mGFP-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AMT (mGFP-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

AMT (GFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

AMT (GFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

AMT (GFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

AMT (GFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

AMT (untagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

AMT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

AMT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Aminomethyltransferase (AMT) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human AMT

Rabbit Polyclonal Anti-AMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMT Antibody: synthetic peptide directed towards the N terminal of human AMT. Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Aminomethyltransferase (29-403, His-tag) human protein, 0.5 mg

Tag His-tag
Expression Host E. coli

Aminomethyltransferase (29-403, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AMT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

AMT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

AMT MS Standard C13 and N15-labeled recombinant protein (NP_000472)

Tag C-Myc/DDK
Expression Host HEK293

AMT (untagged)-Human aminomethyltransferase (AMT) nuclear gene encoding mitochondrial protein transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

AMT (untagged)-Human aminomethyltransferase (AMT) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

AMT (untagged)-Human aminomethyltransferase (AMT) nuclear gene encoding mitochondrial protein transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated