Germany
Japan
United Kingdom
China
IMPDH2 (Myc-DDK-tagged)-Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
IMPDH2 (GFP-tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human IMP (inosine monophosphate) dehydrogenase 2 (IMPDH2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, IMPDH2 (Myc-DDK tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IMPDH2 (mGFP-tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IMPDH2 (Myc-DDK tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IMPDH2 (mGFP-tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
IMPDH2 (untagged)-Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
IMPDH2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 2 (IMPDH2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-IMPDH2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD |
IMPDH2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human IMPDH2 |
IMPDH2 (1-514, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Goat Anti-IMPDH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KEEEHDCFLEEI, from the internal region of the protein sequence according to NP_000875.2. |
Rabbit Polyclonal Anti-IMPDH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the C terminal of human IMPDH2. Synthetic peptide located within the following region: SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF |
Purified recombinant protein of Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2)
| Tag | N-His |
| Expression Host | E. coli |
IMPDH2 (1-514, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) IMPDH2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IMPDH2 MS Standard C13 and N15-labeled recombinant protein (NP_000875)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-IMPDH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IMPDH2 |
IMPDH2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IMPDH2 mouse monoclonal antibody,clone OTI2F10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
IMPDH2 mouse monoclonal antibody,clone OTI2F10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
IMPDH2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of IMPDH2 (NM_000884) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IMPDH2 (NM_000884) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IMPDH2 (NM_000884) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- IMPDH2
Pathways
- Metabolic pathways