Products

View as table Download

LDHB (untagged)-Human lactate dehydrogenase B (LDHB), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

LDHB (GFP-tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, LDHB (Myc-DDK tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, LDHB (mGFP-tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, LDHB (Myc-DDK-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, LDHB (mGFP-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

LDHB (1-334, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

LDHB (1-334, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Lenti ORF clone of Human lactate dehydrogenase B (LDHB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Internal region (near C terminus) (NARGLTSVINQKLK)

LDHB mouse monoclonal antibody, clone AT14D7, Purified

Applications ELISA, WB
Reactivities Human

LDHB mouse monoclonal antibody, clone AT14D7, Purified

Applications ELISA, WB
Reactivities Human

Anti-LDHB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide (KLH-coupled) derived from human LDHB

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (near N terminus) (EEATVPNNKIT)

LDHB MS Standard C13 and N15-labeled recombinant protein (NP_002291)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of LDHB (NM_002300) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of LDHB (NM_001174097) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.

Tag N-His
Expression Host E. coli

Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.

Tag N-His
Expression Host E. coli

Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.

Tag N-His
Expression Host E. coli

Transient overexpression of LDHB (NM_002300) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of LDHB (NM_002300) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of LDHB (NM_001174097) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of LDHB (NM_001174097) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack