Germany
Japan
United Kingdom
China
USD 98.00
USD 390.00
In Stock
MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1b
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 420.00
In Stock
MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1d
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1c
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1a
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
MGST1 (Myc-DDK tagged) - Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
In Stock
MGST1 (GFP-tagged) - Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1b
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 620.00
3 Weeks
Lenti ORF clone of Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1b, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, MGST1 (Myc-DDK tagged) - Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1b, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, MGST1 (mGFP-tagged) - Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1d
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1d, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of MGST1 (mGFP-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1d
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, MGST1 (mGFP-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1d, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1c
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1c, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of MGST1 (mGFP-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1c
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, MGST1 (mGFP-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1c, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1a
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, MGST1 (Myc-DDK-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of MGST1 (mGFP-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1a
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, MGST1 (mGFP-tagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 420.00
3 Weeks
MGST1 (Myc-DDK tagged) - Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 420.00
3 Weeks
MGST1 (Myc-DDK tagged) - Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
3 Weeks
MGST1 (GFP-tagged) - Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1d
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
3 Weeks
MGST1 (GFP-tagged) - Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1c
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
3 Weeks
MGST1 (GFP-tagged) - Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1a
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
3 Weeks
MGST1 (GFP-tagged) - Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
3 Weeks
MGST1 (GFP-tagged) - Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
3 Weeks
MGST1 (GFP-tagged) - Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 310.00
In Stock
MGST1 (untagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1b
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 345.00
In Stock
Rabbit polyclonal anti-MGST1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MGST1. |
USD 440.00
2 Weeks
USD 310.00
In Stock
MGST1 (untagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1d
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 310.00
In Stock
MGST1 (untagged)-Human microsomal glutathione S-transferase 1 (MGST1), transcript variant 1c
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-MGST1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGST1 antibody: synthetic peptide directed towards the N terminal of human MGST1. Synthetic peptide located within the following region: NPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSL |
USD 407.00
2 Weeks
Microsomal Glutathione S transferase 1 (MGST1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 396.00
5 Days
Transient overexpression lysate of microsomal glutathione S-transferase 1 (MGST1), transcript variant 1b
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 355.00
5 Days
Rabbit anti GST Polyclonal Antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | A full length of GST recombinant protein. |
USD 121.00
2 Weeks
MGST1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
2 Weeks
MGST1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
2 Weeks
MGST1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
2 Weeks
MGST1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
2 Weeks
MGST1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
2 Weeks
MGST1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 121.00
2 Weeks
MGST1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 396.00
5 Days
Transient overexpression lysate of microsomal glutathione S-transferase 1 (MGST1), transcript variant 1d
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY407877 is the same product as LY430144.
USD 396.00
5 Days
Transient overexpression lysate of microsomal glutathione S-transferase 1 (MGST1), transcript variant 1c
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY407878 is the same product as LY430145.
USD 396.00
5 Days
Transient overexpression lysate of microsomal glutathione S-transferase 1 (MGST1), transcript variant 1a
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY407879 is the same product as LY430146.
USD 396.00
5 Days
Transient overexpression lysate of microsomal glutathione S-transferase 1 (MGST1), transcript variant 1d
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Active filters
Target Symbol
- MGST1
Pathways
- Metabolism of xenobiotics by cytochrome P450