Germany
Japan
United Kingdom
China
PRDX6 (Myc-DDK-tagged)-Human peroxiredoxin 6 (PRDX6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human peroxiredoxin 6 (PRDX6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, PRDX6 (Myc-DDK tagged) - Human peroxiredoxin 6 (PRDX6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PRDX6 (mGFP-tagged) - Human peroxiredoxin 6 (PRDX6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PRDX6 (GFP-tagged) - Human peroxiredoxin 6 (PRDX6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
5 Weeks
Lenti ORF particles, PRDX6 (Myc-DDK tagged) - Human peroxiredoxin 6 (PRDX6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,020.00
3 Weeks
Lenti ORF particles, PRDX6 (mGFP-tagged) - Human peroxiredoxin 6 (PRDX6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human peroxiredoxin 6 (PRDX6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PRDX6 (untagged)-Human peroxiredoxin 6 (PRDX6)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PRDX6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
Lenti ORF clone of Human peroxiredoxin 6 (PRDX6), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Peroxiredoxin-6 / PRDX6 (1-224, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Peroxiredoxin-6 / PRDX6 (1-224, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Peroxiredoxin 6 (PRDX6) mouse monoclonal antibody, clone 4A3, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
Transient overexpression lysate of peroxiredoxin 6 (PRDX6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-PRDX6 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the middle region of human PRDX6. Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD |
Peroxiredoxin 6 (PRDX6) (C-term) rabbit polyclonal antibody
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human PRDX6. |
PRDX6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Goat Anti-peroxiredoxin 6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EANTTVGRIRFHD, from the internal region (near N terminus) of the protein sequence according to NP_004896.1. |
PRDX6 MS Standard C13 and N15-labeled recombinant protein (NP_004896)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-PRDX6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Transient overexpression of PRDX6 (NM_004905) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human peroxiredoxin 6 (PRDX6)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human peroxiredoxin 6 (PRDX6)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human peroxiredoxin 6 (PRDX6)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human peroxiredoxin 6 (PRDX6)
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of PRDX6 (NM_004905) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- PRDX6
Pathways
- Methane metabolism