PRDX6 (Myc-DDK-tagged)-Human peroxiredoxin 6 (PRDX6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRDX6 (Myc-DDK-tagged)-Human peroxiredoxin 6 (PRDX6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human peroxiredoxin 6 (PRDX6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, PRDX6 (Myc-DDK tagged) - Human peroxiredoxin 6 (PRDX6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, PRDX6 (mGFP-tagged) - Human peroxiredoxin 6 (PRDX6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PRDX6 (GFP-tagged) - Human peroxiredoxin 6 (PRDX6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
5 Weeks
Lenti ORF particles, PRDX6 (Myc-DDK tagged) - Human peroxiredoxin 6 (PRDX6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit anti-PRDX6 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRDX6 |
USD 1,020.00
3 Weeks
Lenti ORF particles, PRDX6 (mGFP-tagged) - Human peroxiredoxin 6 (PRDX6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human peroxiredoxin 6 (PRDX6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PRDX6 (untagged)-Human peroxiredoxin 6 (PRDX6)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PRDX6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
Rabbit monoclonal antibody against Peroxiredoxin 6 (clone EPR3755 )
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Lenti ORF clone of Human peroxiredoxin 6 (PRDX6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Peroxiredoxin-6 / PRDX6 (1-224, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Peroxiredoxin-6 / PRDX6 (1-224, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Peroxiredoxin 6 (PRDX6) mouse monoclonal antibody, clone 4A3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Peroxiredoxin-6 / PRDX6 mouse monoclonal antibody, clone AT22E7, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Peroxiredoxin-6 / PRDX6 mouse monoclonal antibody, clone AT22E7, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Transient overexpression lysate of peroxiredoxin 6 (PRDX6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PRDX6 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the middle region of human PRDX6. Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD |
Peroxiredoxin 6 (PRDX6) mouse monoclonal antibody, Purified
Applications | ELISA, IHC, IP |
Reactivities | Human |
Peroxiredoxin 6 (PRDX6) (C-term) rabbit polyclonal antibody
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human PRDX6. |
PRDX6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Peroxiredoxin 6 (PRDX6) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Sulfonylated peptide (KLH coupled) corresponding to the active site sequence common to mammalian Prx VI |
Goat Anti-peroxiredoxin 6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EANTTVGRIRFHD, from the internal region (near N terminus) of the protein sequence according to NP_004896.1. |
PRDX6 Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | internal region (TAEKRVATPVD) |
Carrier-free (BSA/glycerol-free) PRDX6 mouse monoclonal antibody, clone OTI4D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRDX6 mouse monoclonal antibody, clone OTI3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRDX6 mouse monoclonal antibody, clone OTI11B8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PRDX6 MS Standard C13 and N15-labeled recombinant protein (NP_004896)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-PRDX6 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
Anti-PRDX6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
PRDX6 mouse monoclonal antibody, clone OTI4D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
PRDX6 mouse monoclonal antibody, clone OTI4D1, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
PRDX6 mouse monoclonal antibody, clone OTI4D1, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
PRDX6 mouse monoclonal antibody, clone OTI4D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PRDX6 mouse monoclonal antibody, clone OTI3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
PRDX6 mouse monoclonal antibody, clone OTI3A4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
PRDX6 mouse monoclonal antibody, clone OTI3A4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
PRDX6 mouse monoclonal antibody, clone OTI3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PRDX6 mouse monoclonal antibody, clone OTI11B8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
PRDX6 mouse monoclonal antibody, clone OTI11B8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
PRDX6 mouse monoclonal antibody, clone OTI11B8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
PRDX6 mouse monoclonal antibody, clone OTI11B8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of PRDX6 (NM_004905) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human peroxiredoxin 6 (PRDX6)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human peroxiredoxin 6 (PRDX6)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human peroxiredoxin 6 (PRDX6)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human peroxiredoxin 6 (PRDX6)
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of PRDX6 (NM_004905) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack