Germany
Japan
United Kingdom
China
CDC16 (Myc-DDK-tagged)-Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CDC16 (Myc-DDK-tagged)-Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CDC16 (Myc-DDK tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CDC16 (mGFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CDC16 (GFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC16 (GFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC16 (Myc-DDK tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC16 (mGFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CDC16 (Myc-DDK tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CDC16 (mGFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit polyclonal CDC16/APC6 (Ab-560) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CDC16 (untagged)-Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal CDC16/APC6 (Ser560) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
| Modifications | Phospho-specific |
CDC16 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-APC6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APC6. |
Rabbit polyclonal APC6 phospho T580 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 575-588 of Human Apc6 protein. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDC16 antibody is: synthetic peptide directed towards the N-terminal region of Human CDC16. Synthetic peptide located within the following region: RYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWE |
CDC16 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CDC16 MS Standard C13 and N15-labeled recombinant protein (NP_003894)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CDC16 MS Standard C13 and N15-labeled recombinant protein (NP_001072113)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CDC16 (untagged)-Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CDC16 (untagged)-Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CDC16 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CDC16 |
Transient overexpression of CDC16 (NM_003903) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC16 (NM_001078645) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC16 (NM_003903) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC16 (NM_003903) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CDC16 (NM_001078645) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC16 (NM_001078645) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CDC16
Pathways
- Oocyte meiosis