Germany
Japan
United Kingdom
China
CDC16 (Myc-DDK-tagged)-Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CDC16 (Myc-DDK-tagged)-Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CDC16 (Myc-DDK tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CDC16 (mGFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Cdc16 (Myc-DDK-tagged) - Mouse CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC16 (GFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC16 (GFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC16 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405639 is the updated version of KN205639.
Cdc16 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN502961 is the updated version of KN302961.
Cdc16 (GFP-tagged) - Mouse CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cdc16 (Myc-DDK-tagged) - Mouse CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc16 (Myc-DDK-tagged) - Mouse CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdc16 (mGFP-tagged) - Mouse CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc16 (GFP-tagged) - Mouse CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC16 (Myc-DDK tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC16 (mGFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CDC16 (Myc-DDK tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CDC16 (mGFP-tagged) - Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cdc16 (Myc-DDK-tagged ORF) - Rat CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cdc16 (Myc-DDK-tagged ORF) - Rat CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc16 (Myc-DDK-tagged ORF) - Rat CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdc16 (mGFP-tagged ORF) - Rat CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc16 (GFP-tagged ORF) - Rat CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit polyclonal CDC16/APC6 (Ab-560) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CDC16 (untagged)-Human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Cdc16 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal CDC16/APC6 (Ser560) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
| Modifications | Phospho-specific |
CDC16 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Cdc16 (untagged) - Mouse CDC16 cell division cycle 16 homolog (S. cerevisiae) (Cdc16), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-APC6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APC6. |
Rabbit polyclonal APC6 phospho T580 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 575-588 of Human Apc6 protein. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDC16 antibody is: synthetic peptide directed towards the N-terminal region of Human CDC16. Synthetic peptide located within the following region: RYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWE |
CDC16 CRISPRa kit - CRISPR gene activation of human cell division cycle 16
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cdc16 CRISPRa kit - CRISPR gene activation of mouse CDC16 cell division cycle 16
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CDC16
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CDC16
CDC16 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Cdc16
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Cdc16
Active filters
Target Symbol
- CDC16