ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ATP6V0E2 (Myc-DDK tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ATP6V0E2 (mGFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATP6V0E2 (mGFP-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP6V0E2 (mGFP-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP6V0E2 (Myc-DDK tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP6V0E2 (mGFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP6V0E2 (myc-DDK-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATP6V0E2 (GFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP6V0E2 (GFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ATP6V0E2 Antibody
Reactivities | Human, Horse, Rabbit, Rat, Guinea pig, Dog, Bovine, Mouse, Zebrafish |
Rabbit Polyclonal Anti-ATP6V0E2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP6V0E2 antibody: synthetic peptide directed towards the middle region of human ATP6V0E2. Synthetic peptide located within the following region: TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP |
ATP6V0E2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ATP6V0E2 (GFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP6V0E2 (untagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ATP6V0E2 (untagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
ATP6V0E2 (untagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of ATP6V0E2 (NM_145230) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP6V0E2 (NM_001100592) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP6V0E2 (NM_001289990) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP6V0E2 (NM_145230) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ATP6V0E2 (NM_001100592) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATP6V0E2 (NM_001100592) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ATP6V0E2 (NM_001289990) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack