Products

cDNA Clones (21)
Proteins (9)
Antibodies (2)
Jump to Filters
View as table Download
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170

USD 420.00

In Stock

ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone Lentiviral Particle
RC224170L1V

USD 820.00

3 Weeks

Lenti ORF particles, ATP6V0E2 (Myc-DDK tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone Lentiviral Particle
RC224170L2V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V0E2 (mGFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone
RC219960

USD 420.00

3 Weeks

ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone
RC219960L3

USD 620.00

8 Weeks

Lenti-ORF clone of ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone Lentiviral Particle
RC219960L3V

USD 820.00

11 Weeks

Lenti ORF particles, ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone
RC219960L4

USD 620.00

8 Weeks

Lenti-ORF clone of ATP6V0E2 (mGFP-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone Lentiviral Particle
RC219960L4V

USD 820.00

11 Weeks

Lenti ORF particles, ATP6V0E2 (mGFP-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone Lentiviral Particle
RC224170L3V

USD 820.00

7 Weeks

Lenti ORF particles, ATP6V0E2 (Myc-DDK tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone Lentiviral Particle
RC224170L4V

USD 820.00

7 Weeks

Lenti ORF particles, ATP6V0E2 (mGFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001289990) Human Tagged ORF Clone
RC236804

USD 420.00

2 Weeks

ATP6V0E2 (myc-DDK-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone
RG219960

USD 460.00

3 Weeks

ATP6V0E2 (GFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RG224170

USD 460.00

3 Weeks

ATP6V0E2 (GFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170L1

USD 768.00

In Stock

Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ATP6V0E2 Rabbit Antibody
TA331647

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP6V0E2 Antibody

Reactivities Human, Horse, Rabbit, Rat, Guinea pig, Dog, Bovine, Mouse, Zebrafish
ATP6V0E2 Rabbit Polyclonal Antibody
TA339996

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP6V0E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0E2 antibody: synthetic peptide directed towards the middle region of human ATP6V0E2. Synthetic peptide located within the following region: TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP
ATP6V0E2 (NM_001100592) Human Over-expression Lysate
LC420273

USD 121.00

2 Weeks

ATP6V0E2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ATP6V0E2 (NM_001100592) Human Over-expression Lysate
LY420273

USD 396.00

5 Days

Transient overexpression lysate of ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ATP6V0E2 (NM_001289990) Human Tagged ORF Clone
RG236804

USD 460.00

2 Weeks

ATP6V0E2 (GFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0E2 (NM_001100592) Human Untagged Clone
SC316681

USD 420.00

3 Weeks

ATP6V0E2 (untagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V0E2 (NM_145230) Human Untagged Clone
SC317233

USD 420.00

3 Weeks

ATP6V0E2 (untagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pCMV6 series
Tag Tag Free
ATP6V0E2 (NM_001289990) Human Untagged Clone
SC334698

USD 477.00

2 Weeks

ATP6V0E2 (untagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V0E2 (NM_145230) ICC Control Block
TB419960

USD 1,070.00

4 Weeks

Transient overexpression of ATP6V0E2 (NM_145230) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP6V0E2 (NM_001100592) ICC Control Block
TB424170

USD 1,070.00

4 Weeks

Transient overexpression of ATP6V0E2 (NM_001100592) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP6V0E2 (NM_001289990) ICC Control Block
TB436804

USD 1,070.00

4 Weeks

Transient overexpression of ATP6V0E2 (NM_001289990) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP6V0E2 ICC Control Sections
TS419960P5

USD 889.00

4 Weeks

Transient overexpression of ATP6V0E2 (NM_145230) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ATP6V0E2 Cytosection
TS424170

USD 225.00

4 Weeks

Transient overexpression of ATP6V0E2 (NM_001100592) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ATP6V0E2 Cytosection
TS424170P5

USD 889.00

4 Weeks

Transient overexpression of ATP6V0E2 (NM_001100592) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ATP6V0E2 ICC Control Sections
TS436804P5

USD 889.00

4 Weeks

Transient overexpression of ATP6V0E2 (NM_001289990) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack