Products

cDNA Clones (37)
RNAi (12)
Proteins (9)
Gene Expression (7)
Antibodies (2)
Jump to Filters
View as table Download
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170

USD 420.00

In Stock

ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone Lentiviral Particle
RC224170L1V

USD 820.00

3 Weeks

Lenti ORF particles, ATP6V0E2 (Myc-DDK tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone Lentiviral Particle
RC224170L2V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V0E2 (mGFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Atp6v0e2 (NM_133764) Mouse Tagged ORF Clone
MR200146

USD 68.00

USD 390.00

In Stock

Atp6v0e2 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V0 subunit E2 (Atp6v0e2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0E2 Human Gene Knockout Kit (CRISPR)
KN419960

USD 1,290.00

2 Weeks

ATP6V0E2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN419960 is the updated version of KN219960.
Atp6v0e2 Mouse Gene Knockout Kit (CRISPR)
KN501815

USD 1,290.00

2 Weeks

Atp6v0e2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN501815 is the updated version of KN301815.
Atp6v0e2 (NM_133764) Mouse Tagged ORF Clone
MG200146

USD 300.00

3 Weeks

Atp6v0e2 (GFP-tagged) - Mouse ATPase, H+ transporting, lysosomal V0 subunit E2 (Atp6v0e2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Atp6v0e2 (NM_133764) Mouse Tagged ORF Clone
MR200146L3

USD 500.00

3 Weeks

Lenti ORF clone of Atp6v0e2 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V0 subunit E2 (Atp6v0e2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v0e2 (NM_133764) Mouse Tagged ORF Clone Lentiviral Particle
MR200146L3V

USD 700.00

6 Weeks

Lenti ORF particles, Atp6v0e2 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V0 subunit E2 (Atp6v0e2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v0e2 (NM_133764) Mouse Tagged ORF Clone
MR200146L4

USD 500.00

3 Weeks

Lenti ORF clone of Atp6v0e2 (mGFP-tagged) - Mouse ATPase, H+ transporting, lysosomal V0 subunit E2 (Atp6v0e2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v0e2 (NM_133764) Mouse Tagged ORF Clone Lentiviral Particle
MR200146L4V

USD 700.00

6 Weeks

Lenti ORF particles, Atp6v0e2 (GFP-tagged) - Mouse ATPase, H+ transporting, lysosomal V0 subunit E2 (Atp6v0e2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone
RC219960

USD 420.00

3 Weeks

ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone
RC219960L3

USD 620.00

8 Weeks

Lenti-ORF clone of ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone Lentiviral Particle
RC219960L3V

USD 820.00

11 Weeks

Lenti ORF particles, ATP6V0E2 (Myc-DDK-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone
RC219960L4

USD 620.00

8 Weeks

Lenti-ORF clone of ATP6V0E2 (mGFP-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone Lentiviral Particle
RC219960L4V

USD 820.00

11 Weeks

Lenti ORF particles, ATP6V0E2 (mGFP-tagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone Lentiviral Particle
RC224170L3V

USD 820.00

7 Weeks

Lenti ORF particles, ATP6V0E2 (Myc-DDK tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone Lentiviral Particle
RC224170L4V

USD 820.00

7 Weeks

Lenti ORF particles, ATP6V0E2 (mGFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001289990) Human Tagged ORF Clone
RC236804

USD 420.00

2 Weeks

ATP6V0E2 (myc-DDK-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0E2 (NM_145230) Human Tagged ORF Clone
RG219960

USD 460.00

3 Weeks

ATP6V0E2 (GFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RG224170

USD 460.00

3 Weeks

ATP6V0E2 (GFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Atp6v0e2 (NM_001002253) Rat Tagged ORF Clone
RR203306

USD 420.00

3 Weeks

Atp6v0e2 (Myc-DDK-tagged ORF) - Rat ATPase, H+ transporting V0 subunit e2 (Atp6v0e2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Atp6v0e2 (NM_001002253) Rat Tagged ORF Clone
RR203306L3

USD 640.00

7 Weeks

Lenti ORF clone of Atp6v0e2 (Myc-DDK-tagged ORF) - Rat ATPase, H+ transporting V0 subunit e2 (Atp6v0e2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v0e2 (NM_001002253) Rat Tagged ORF Clone Lentiviral Particle
RR203306L3V

USD 850.00

11 Weeks

Lenti ORF particles, Atp6v0e2 (Myc-DDK-tagged ORF) - Rat ATPase, H+ transporting V0 subunit e2 (Atp6v0e2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v0e2 (NM_001002253) Rat Tagged ORF Clone
RR203306L4

USD 700.00

7 Weeks

Lenti ORF clone of Atp6v0e2 (mGFP-tagged ORF) - Rat ATPase, H+ transporting V0 subunit e2 (Atp6v0e2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v0e2 (NM_001002253) Rat Tagged ORF Clone Lentiviral Particle
RR203306L4V

USD 960.00

11 Weeks

Lenti ORF particles, Atp6v0e2 (GFP-tagged ORF) - Rat ATPase, H+ transporting V0 subunit e2 (Atp6v0e2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170L1

USD 768.00

In Stock

Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ATP6V0E2 (NM_001100592) Human Tagged ORF Clone
RC224170L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Atp6v0e2 Mouse siRNA Oligo Duplex (Locus ID 76252)
SR400540

USD 430.00

In Stock

Atp6v0e2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Atp6v0e2 (NM_133764) Mouse Untagged Clone
MC201106

USD 210.00

In Stock

Atp6v0e2 (untagged) - Mouse ATPase, H+ transporting, lysosomal V0 subunit E2 (Atp6v0e2), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V0E2 Rabbit Antibody
TA331647

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP6V0E2 Antibody

Reactivities Human, Horse, Rabbit, Rat, Guinea pig, Dog, Bovine, Mouse, Zebrafish
ATP6V0E2 Rabbit Polyclonal Antibody
TA339996

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP6V0E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0E2 antibody: synthetic peptide directed towards the middle region of human ATP6V0E2. Synthetic peptide located within the following region: TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP
Human ATP6V0E2 activation kit by CRISPRa
GA115910

USD 1,290.00

2 Weeks

ATP6V0E2 CRISPRa kit - CRISPR gene activation of human ATPase H+ transporting V0 subunit e2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Atp6v0e2 activation kit by CRISPRa
GA210467

USD 1,290.00

2 Weeks

Atp6v0e2 CRISPRa kit - CRISPR gene activation of mouse ATPase, H+ transporting, lysosomal V0 subunit E2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
ATP6V0E2 Human qPCR Primer Pair (NM_145230)
HP229543

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene ATP6V0E2

ATP6V0E2 (NM_001100592) Human Over-expression Lysate
LC420273

USD 121.00

2 Weeks

ATP6V0E2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ATP6V0E2 (NM_001100592) Human Over-expression Lysate
LY420273

USD 396.00

5 Days

Transient overexpression lysate of ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Atp6v0e2 Mouse qPCR Template Standard (NM_133764)
MK200739

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Atp6v0e2

Application Plasmid of exact quantity for transcript copy number calculation
Atp6v0e2 Mouse qPCR Primer Pair (NM_133764)
MP201093

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Atp6v0e2

Mouse Atp6v0e2 (NM_133764) AAV Particle
MR200146A1V

USD 850.00

4 Weeks

AAV ORF Particles, serotype AAV-2, Atp6v0e2 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V0 subunit E2 (Atp6v0e2), 250ul, >10^13 TU/mL

  • AAV ORF®
ATP6V0E2 (NM_001289990) Human Tagged ORF Clone
RG236804

USD 460.00

2 Weeks

ATP6V0E2 (GFP-tagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Atp6v0e2 (NM_001002253) Rat Untagged Clone
RN203306

USD 420.00

3 Weeks

Atp6v0e2 (untagged ORF) - Rat ATPase, H+ transporting V0 subunit e2 (Atp6v0e2), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V0E2 (NM_001100592) Human 3' UTR Clone
SC211453

USD 560.00

4 Weeks

3`UTR clone of ATPase H+ transporting V0 subunit e2 (ATP6V0E2) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
ATP6V0E2 (NM_145230) Human 3' UTR Clone
SC214283

USD 560.00

4 Weeks

3`UTR clone of ATPase H+ transporting V0 subunit e2 (ATP6V0E2) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
ATP6V0E2 (NM_001100592) Human Untagged Clone
SC316681

USD 420.00

3 Weeks

ATP6V0E2 (untagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V0E2 (NM_145230) Human Untagged Clone
SC317233

USD 420.00

3 Weeks

ATP6V0E2 (untagged)-Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 1

Vector pCMV6 series
Tag Tag Free
ATP6V0E2 (NM_001289990) Human Untagged Clone
SC334698

USD 477.00

2 Weeks

ATP6V0E2 (untagged) - Human ATPase, H+ transporting V0 subunit e2 (ATP6V0E2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V0E2 Human siRNA Oligo Duplex (Locus ID 155066)
SR315894

USD 430.00

2 Weeks

ATP6V0E2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100