Products

cDNA Clones (22)
Proteins (13)
Antibodies (6)
Jump to Filters
View as table Download
CPT1A (NM_001031847) Human Tagged ORF Clone
RC200485

USD 98.00

USD 560.00

In Stock

CPT1A (Myc-DDK-tagged)-Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CPT1A (NM_001876) Human Tagged ORF Clone
RC221740

USD 610.00

In Stock

CPT1A (Myc-DDK-tagged)-Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CPT1A (NM_001876) Human Tagged ORF Clone
RG221740

USD 670.00

In Stock

CPT1A (GFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CPT1A (NM_001031847) Human Tagged ORF Clone Lentiviral Particle
RC200485L1V

USD 1,332.00

2 Weeks

Lenti ORF particles, CPT1A (Myc-DDK tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CPT1A (NM_001031847) Human Tagged ORF Clone Lentiviral Particle
RC200485L2V

USD 1,332.00

5 Weeks

Lenti ORF particles, CPT1A (mGFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone Lentiviral Particle
RC221740L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, CPT1A (Myc-DDK tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone Lentiviral Particle
RC221740L2V

USD 1,010.00

3 Weeks

Lenti ORF particles, CPT1A (mGFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CPT1A (NM_001031847) Human Tagged ORF Clone
RG200485

USD 750.00

In Stock

CPT1A (GFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CPT1A (NM_001031847) Human Tagged ORF Clone Lentiviral Particle
RC200485L3V

USD 1,332.00

5 Weeks

Lenti ORF particles, CPT1A (Myc-DDK tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001031847) Human Tagged Lenti ORF Clone
RC200485L4

USD 1,092.00

In Stock

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001031847) Human Tagged ORF Clone Lentiviral Particle
RC200485L4V

USD 1,332.00

2 Weeks

Lenti ORF particles, CPT1A (mGFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone
RC221740L3

USD 810.00

3 Weeks

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone Lentiviral Particle
RC221740L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, CPT1A (Myc-DDK tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone
RC221740L4

USD 810.00

3 Weeks

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone Lentiviral Particle
RC221740L4V

USD 1,010.00

5 Weeks

Lenti ORF particles, CPT1A (mGFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A Rabbit Polyclonal Antibody
TA332600

USD 275.00

3 Weeks

Rabbit anti-CPT1A Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CPT1A
CPT1A (NM_001876) Human Tagged ORF Clone
RC221740L1

USD 1,008.00

In Stock

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CPT1A (NM_001876) Human Tagged Lenti ORF Clone
RC221740L2

USD 1,008.00

In Stock

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CPT1A Goat Polyclonal Antibody
TA303144

USD 375.00

2 Weeks

Goat Polyclonal Antibody against CPT1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.
CPT1A (NM_001031847) Human Tagged Lenti ORF Clone
RC200485L3

USD 1,092.00

3 Weeks

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001031847) Human Tagged Lenti ORF Clone
RC200485L1

USD 1,092.00

In Stock

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CPT1A (NM_001031847) Human Untagged Clone
SC321568

USD 760.00

In Stock

CPT1A (untagged)-Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CPT1A (NM_001876) Human Untagged Clone
SC119000

USD 1,570.00

In Stock

CPT1A (untagged)-Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
CPT1A (621-634) Goat Polyclonal Antibody
AP22505PU-N

USD 440.00

2 Weeks

CPT1A (621-634) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CPT1A
CPT1A (NM_001031847) Human Over-expression Lysate
LC422204

USD 121.00

In Stock

CPT1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPT1A (NM_001031847) Human Tagged Lenti ORF Clone
RC200485L2

USD 1,092.00

3 Weeks

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CPT1A (NM_001031847) Human Over-expression Lysate
LY422204

USD 396.00

5 Days

Transient overexpression lysate of carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPT1A Rabbit Polyclonal Antibody
TA336036

USD 375.00

5 Days

Rabbit Polyclonal Anti-CPT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CPT1A Antibody: synthetic peptide directed towards the middle region of human CPT1A. Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN
CPT1A (NM_001876) Human Over-expression Lysate
LC419675

USD 187.00

2 Weeks

CPT1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPT1A (NM_001876) Human Over-expression Lysate
LC429082

USD 187.00

2 Weeks

CPT1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPT1A (NM_001876) Human Over-expression Lysate
LY419675

USD 605.00

5 Days

Transient overexpression lysate of carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY419675 is the same product as LY429082.
CPT1A (NM_001876) Human Over-expression Lysate
LY429082

USD 605.00

5 Days

Transient overexpression lysate of carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPT1A (NM_001876) Human Mass Spec Standard
PH321740

USD 2,055.00

3 Weeks

CPT1A MS Standard C13 and N15-labeled recombinant protein (NP_001867)

Tag C-Myc/DDK
Expression Host HEK293
CPT1A Rabbit Polyclonal Antibody
TA323382

USD 345.00

4 Weeks

Anti-CPT1A Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human carnitine palmitoyltransferase 1A (liver)
CPT1A Rabbit Polyclonal Antibody
TA323383

USD 345.00

In Stock

Anti-CPT1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human carnitine palmitoyltransferase 1A (liver)
CPT1A ICC Control Block
TB400485

USD 1,210.00

4 Weeks

Transient overexpression of CPT1A (NM_001031847) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CPT1A ICC Control Block
TB421740

USD 1,260.00

4 Weeks

Transient overexpression of CPT1A (NM_001876) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CPT1A Cytosection
TS400485

USD 225.00

4 Weeks

Transient overexpression of CPT1A (NM_001031847) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CPT1A Cytosection
TS400485P5

USD 889.00

4 Weeks

Transient overexpression of CPT1A (NM_001031847) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CPT1A Cytosection
TS421740

USD 225.00

4 Weeks

Transient overexpression of CPT1A (NM_001876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CPT1A Cytosection
TS421740P5

USD 889.00

4 Weeks

Transient overexpression of CPT1A (NM_001876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack