Products

cDNA Clones (36)
Proteins (14)
Gene Expression (12)
RNAi (12)
Antibodies (8)
Jump to Filters
View as table Download
CPT1A (NM_001031847) Human Tagged ORF Clone
RC200485

USD 98.00

USD 560.00

In Stock

CPT1A (Myc-DDK-tagged)-Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CPT1A (NM_001876) Human Tagged ORF Clone
RC221740

USD 610.00

In Stock

CPT1A (Myc-DDK-tagged)-Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CPT1A (NM_001876) Human Tagged ORF Clone
RG221740

USD 670.00

In Stock

CPT1A (GFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cpt1a (NM_013495) Mouse Tagged ORF Clone
MR210568

USD 610.00

In Stock

Cpt1a (Myc-DDK-tagged) - Mouse carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CPT1A (NM_001031847) Human Tagged ORF Clone Lentiviral Particle
RC200485L1V

USD 1,332.00

2 Weeks

Lenti ORF particles, CPT1A (Myc-DDK tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CPT1A (NM_001031847) Human Tagged ORF Clone Lentiviral Particle
RC200485L2V

USD 1,332.00

5 Weeks

Lenti ORF particles, CPT1A (mGFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone Lentiviral Particle
RC221740L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, CPT1A (Myc-DDK tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone Lentiviral Particle
RC221740L2V

USD 1,010.00

3 Weeks

Lenti ORF particles, CPT1A (mGFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CPT1A (NM_001031847) Human Tagged ORF Clone
RG200485

USD 750.00

In Stock

CPT1A (GFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cpt1a (NM_013495) Mouse Tagged ORF Clone
MG210568

USD 670.00

In Stock

Cpt1a (GFP-tagged) - Mouse carnitine palmitoyltransferase 1a, liver (Cpt1a)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CPT1A Human Gene Knockout Kit (CRISPR)
KN400485

USD 1,290.00

2 Weeks

CPT1A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400485 is the updated version of KN200485.
Cpt1a Mouse Gene Knockout Kit (CRISPR)
KN503783

USD 1,290.00

2 Weeks

Cpt1a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503783 is the updated version of KN303783.
Cpt1a (NM_013495) Mouse Tagged ORF Clone
MR210568L3

USD 810.00

3 Weeks

Lenti ORF clone of Cpt1a (Myc-DDK-tagged) - Mouse carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cpt1a (NM_013495) Mouse Tagged ORF Clone Lentiviral Particle
MR210568L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, Cpt1a (Myc-DDK-tagged) - Mouse carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cpt1a (NM_013495) Mouse Tagged ORF Clone
MR210568L4

USD 810.00

3 Weeks

Lenti ORF clone of Cpt1a (mGFP-tagged) - Mouse carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cpt1a (NM_013495) Mouse Tagged ORF Clone Lentiviral Particle
MR210568L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, Cpt1a (GFP-tagged) - Mouse carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001031847) Human Tagged ORF Clone Lentiviral Particle
RC200485L3V

USD 1,332.00

5 Weeks

Lenti ORF particles, CPT1A (Myc-DDK tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001031847) Human Tagged Lenti ORF Clone
RC200485L4

USD 1,092.00

In Stock

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001031847) Human Tagged ORF Clone Lentiviral Particle
RC200485L4V

USD 1,332.00

2 Weeks

Lenti ORF particles, CPT1A (mGFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone
RC221740L3

USD 810.00

3 Weeks

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone Lentiviral Particle
RC221740L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, CPT1A (Myc-DDK tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone
RC221740L4

USD 810.00

3 Weeks

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A (NM_001876) Human Tagged ORF Clone Lentiviral Particle
RC221740L4V

USD 1,010.00

5 Weeks

Lenti ORF particles, CPT1A (mGFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cpt1a (NM_031559) Rat Tagged ORF Clone
RR202656

USD 1,050.00

5 Weeks

Cpt1a (Myc-DDK-tagged ORF) - Rat carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cpt1a (NM_031559) Rat Tagged ORF Clone
RR202656L3

USD 1,240.00

10 Weeks

Lenti ORF clone of Cpt1a (Myc-DDK-tagged ORF) - Rat carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cpt1a (NM_031559) Rat Tagged ORF Clone Lentiviral Particle
RR202656L3V

USD 1,450.00

14 Weeks

Lenti ORF particles, Cpt1a (Myc-DDK-tagged ORF) - Rat carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cpt1a (NM_031559) Rat Tagged ORF Clone
RR202656L4

USD 1,360.00

10 Weeks

Lenti ORF clone of Cpt1a (mGFP-tagged ORF) - Rat carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cpt1a (NM_031559) Rat Tagged ORF Clone Lentiviral Particle
RR202656L4V

USD 1,620.00

14 Weeks

Lenti ORF particles, Cpt1a (GFP-tagged ORF) - Rat carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A Rabbit Polyclonal Antibody
TA332600

USD 275.00

3 Weeks

Rabbit anti-CPT1A Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CPT1A
Cpt1a (NM_013495) Mouse Untagged Clone
MC205196

USD 210.00

In Stock

Cpt1a (untagged) - Mouse carnitine palmitoyltransferase 1a, liver (Cpt1a), nuclear gene encoding mitochondrial protein, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
CPT1A (NM_001876) Human Tagged ORF Clone
RC221740L1

USD 1,008.00

In Stock

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CPT1A (NM_001876) Human Tagged Lenti ORF Clone
RC221740L2

USD 1,008.00

In Stock

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CPT1A Goat Polyclonal Antibody
TA303144

USD 375.00

2 Weeks

Goat Polyclonal Antibody against CPT1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.
CPT1A (NM_001031847) Human Tagged Lenti ORF Clone
RC200485L3

USD 1,092.00

3 Weeks

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPT1A Human qPCR Primer Pair (NM_001876)
HP234003

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CPT1A

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
CPT1A (NM_001031847) Human Tagged Lenti ORF Clone
RC200485L1

USD 1,092.00

In Stock

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Cpt1a Mouse shRNA Plasmid (Locus ID 12894)
TG500417

USD 715.00

In Stock

Cpt1a - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
CPT1A (NM_001031847) Human Untagged Clone
SC321568

USD 760.00

In Stock

CPT1A (untagged)-Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CPT1A Human siRNA Oligo Duplex (Locus ID 1374)
SR319790

USD 430.00

In Stock

CPT1A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SR319790 is the updated version of SR300965.
CPT1A (NM_001876) Human Untagged Clone
SC119000

USD 1,570.00

In Stock

CPT1A (untagged)-Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Cpt1a Mouse siRNA Oligo Duplex (Locus ID 12894)
SR420006

USD 430.00

In Stock

Cpt1a (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

CPT1A Human shRNA Plasmid Kit (Locus ID 1374)
TR313747

USD 715.00

In Stock

CPT1A - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
CPT1A (621-634) Goat Polyclonal Antibody
AP22505PU-N

USD 440.00

2 Weeks

CPT1A (621-634) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CPT1A
CPT1A (NM_001031847) Human Over-expression Lysate
LC422204

USD 121.00

In Stock

CPT1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPT1A (NM_001031847) Human Tagged Lenti ORF Clone
RC200485L2

USD 1,092.00

3 Weeks

Lenti ORF clone of Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CPT1A Human shRNA Lentiviral Particle (Locus ID 1374)
TL313747V

USD 1,395.00

In Stock

CPT1A - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
CPT1A Human Gene Knockout Kit (CRISPR)
KN200485RB

USD 1,290.00

4 Weeks

CPT1A - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA RFP-BSD
CPT1A (NM_001031847) Human Over-expression Lysate
LY422204

USD 396.00

5 Days

Transient overexpression lysate of carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cpt1a Mouse qPCR Primer Pair (NM_013495)
MP201754

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Cpt1a

CPT1A Rabbit Polyclonal Antibody
TA336036

USD 375.00

5 Days

Rabbit Polyclonal Anti-CPT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CPT1A Antibody: synthetic peptide directed towards the middle region of human CPT1A. Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN