Products

cDNA Clones (23)
Proteins (17)
Antibodies (1)
Jump to Filters
View as table Download
RALGDS (NM_001042368) Human Tagged ORF Clone
RC222398

USD 960.00

In Stock

RALGDS (Myc-DDK-tagged)-Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RALGDS (NM_006266) Human Tagged ORF Clone
RC216933

USD 1,010.00

In Stock

RALGDS (Myc-DDK-tagged)-Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RALGDS (NM_006266) Human Tagged ORF Clone
RG216933

USD 1,110.00

In Stock

RALGDS (GFP-tagged) - Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RALGDS (NM_001271774) Human Tagged ORF Clone
RG234993

USD 830.00

In Stock

RALGDS (GFP-tagged) - Homo sapiens ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RALGDS (NM_006266) Human Tagged ORF Clone
RC216933L3

USD 1,210.00

3 Weeks

Lenti-ORF clone of RALGDS (Myc-DDK-tagged)-Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RALGDS (NM_006266) Human Tagged ORF Clone Lentiviral Particle
RC216933L3V

USD 1,410.00

6 Weeks

Lenti ORF particles, RALGDS (Myc-DDK-tagged)-Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RALGDS (NM_006266) Human Tagged ORF Clone
RC216933L4

USD 1,210.00

3 Weeks

Lenti-ORF clone of RALGDS (mGFP-tagged)-Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RALGDS (NM_006266) Human Tagged ORF Clone Lentiviral Particle
RC216933L4V

USD 1,410.00

6 Weeks

Lenti ORF particles, RALGDS (mGFP-tagged)-Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RALGDS (NM_001042368) Human Tagged ORF Clone
RC222398L3

USD 1,160.00

3 Weeks

Lenti ORF clone of Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RALGDS (NM_001042368) Human Tagged ORF Clone Lentiviral Particle
RC222398L3V

USD 1,360.00

6 Weeks

Lenti ORF particles, RALGDS (Myc-DDK tagged) - Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RALGDS (NM_001042368) Human Tagged ORF Clone
RC222398L4

USD 1,160.00

3 Weeks

Lenti ORF clone of Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RALGDS (NM_001042368) Human Tagged ORF Clone Lentiviral Particle
RC222398L4V

USD 1,360.00

6 Weeks

Lenti ORF particles, RALGDS (mGFP-tagged) - Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RALGDS (NM_001271774) Human Tagged ORF Clone
RC234993

USD 750.00

3 Weeks

RALGDS (Myc-DDK tagged) - Homo sapiens ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RALGDS (NM_001271776) Human Tagged ORF Clone
RC235009

USD 750.00

5 Weeks

RALGDS (Myc-DDK tagged) - Homo sapiens ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RALGDS (NM_001271775) Human Tagged ORF Clone
RC235027

USD 750.00

5 Weeks

RALGDS (Myc-DDK tagged) - Homo sapiens ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RALGDS (NM_001042368) Human Tagged ORF Clone
RG222398

USD 1,060.00

3 Weeks

RALGDS (GFP-tagged) - Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RALGDS (NM_001271776) Human Tagged ORF Clone
RG235009

USD 830.00

5 Weeks

RALGDS (GFP-tagged) - Homo sapiens ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RALGDS (NM_001271775) Human Tagged ORF Clone
RG235027

USD 830.00

5 Weeks

RALGDS (GFP-tagged) - Homo sapiens ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RALGDS Rabbit Polyclonal Antibody
TA335961

USD 375.00

5 Days

Rabbit Polyclonal Anti-RALGDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RALGDS Antibody: synthetic peptide directed towards the N terminal of human RALGDS. Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED
RALGDS (NM_006266) Human Untagged Clone
SC100409

USD 1,850.00

In Stock

RALGDS (untagged)-Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
RALGDS (NM_006266) Human Over-expression Lysate
LY416759

USD 396.00

5 Days

Transient overexpression lysate of ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RALGDS (NM_006266) Human Over-expression Lysate
LC416759

USD 121.00

2 Weeks

RALGDS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RALGDS (NM_001042368) Human Over-expression Lysate
LC420857

USD 187.00

2 Weeks

RALGDS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RALGDS (NM_001042368) Human Over-expression Lysate
LY420857

USD 605.00

5 Days

Transient overexpression lysate of ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RALGDS (NM_006266) Human Mass Spec Standard
PH316933

USD 2,055.00

3 Weeks

RALGDS MS Standard C13 and N15-labeled recombinant protein (NP_006257)

Tag C-Myc/DDK
Expression Host HEK293
RALGDS (NM_001042368) Human Untagged Clone
SC311316

USD 1,750.00

3 Weeks

RALGDS (untagged)-Human ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RALGDS (NM_001271774) Human Untagged Clone
SC333105

USD 900.00

5 Weeks

RALGDS (untagged) - Homo sapiens ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 3

Vector pCMV6 series
Tag Tag Free
RALGDS (NM_001271775) Human Untagged Clone
SC333106

USD 920.00

5 Weeks

RALGDS (untagged) - Homo sapiens ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 4

Vector pCMV6 series
Tag Tag Free
RALGDS (NM_001271776) Human Untagged Clone
SC333107

USD 910.00

5 Weeks

RALGDS (untagged) - Homo sapiens ral guanine nucleotide dissociation stimulator (RALGDS), transcript variant 5

Vector pCMV6 series
Tag Tag Free
RALGDS ICC Control Block
TB416933

USD 1,660.00

4 Weeks

Transient overexpression of RALGDS (NM_006266) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RALGDS ICC Control Block
TB422398

USD 1,610.00

4 Weeks

Transient overexpression of RALGDS (NM_001042368) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RALGDS ICC Control Block
TB434993

USD 1,400.00

4 Weeks

Transient overexpression of RALGDS (NM_001271774) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RALGDS ICC Control Block
TB435009

USD 1,400.00

4 Weeks

Transient overexpression of RALGDS (NM_001271776) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RALGDS ICC Control Block
TB435027

USD 1,400.00

4 Weeks

Transient overexpression of RALGDS (NM_001271775) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RALGDS Cytosection
TS416933

USD 225.00

4 Weeks

Transient overexpression of RALGDS (NM_006266) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RALGDS Cytosection
TS416933P5

USD 889.00

4 Weeks

Transient overexpression of RALGDS (NM_006266) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RALGDS Cytosection
TS422398

USD 225.00

4 Weeks

Transient overexpression of RALGDS (NM_001042368) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RALGDS Cytosection
TS422398P5

USD 889.00

4 Weeks

Transient overexpression of RALGDS (NM_001042368) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RALGDS ICC Control Sections
TS434993P5

USD 889.00

4 Weeks

Transient overexpression of RALGDS (NM_001271774) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RALGDS ICC Control Sections
TS435009P5

USD 889.00

4 Weeks

Transient overexpression of RALGDS (NM_001271776) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RALGDS ICC Control Sections
TS435027P5

USD 889.00

4 Weeks

Transient overexpression of RALGDS (NM_001271775) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack