Germany
Japan
United Kingdom
China
CDK4 (Myc-DDK-tagged)-Human cyclin-dependent kinase 4 (CDK4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CDK4 (mGFP-tagged) - Human cyclin-dependent kinase 4 (CDK4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CDK4 (untagged)-Human cyclin-dependent kinase 4 (CDK4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC112998 is the updated version of SC113109.
Recombinant protein of human cyclin-dependent kinase 4 (CDK4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
CDK4 Mutant (R24C), Myc-DDK-tagged ORF clone of Homo sapiens cyclin-dependent kinase 4 (CDK4) as transfection-ready DNA
| Mutation | R24C |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CDK4 (Myc-DDK tagged) - Human cyclin-dependent kinase 4 (CDK4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CDK4 (mGFP-tagged) - Human cyclin-dependent kinase 4 (CDK4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, CDK4 (Myc-DDK tagged) - Human cyclin-dependent kinase 4 (CDK4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CDK4 Mutant (R24H), Myc-DDK-tagged ORF clone of Homo sapiens cyclin-dependent kinase 4 (CDK4) as transfection-ready DNA
| Mutation | R24H |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDK4 Mutant (N41S), Myc-DDK-tagged ORF clone of Homo sapiens cyclin-dependent kinase 4 (CDK4) as transfection-ready DNA
| Mutation | N41S |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDK4 Mutant (S52N), Myc-DDK-tagged ORF clone of Homo sapiens cyclin-dependent kinase 4 (CDK4) as transfection-ready DNA
| Mutation | S52N |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDK4 (GFP-tagged) - Human cyclin-dependent kinase 4 (CDK4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cyclin-dependent kinase 4 (CDK4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human cyclin-dependent kinase 4 (CDK4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human cyclin-dependent kinase 4 (CDK4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
CDK4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of cyclin-dependent kinase 4 (CDK4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CDK4 (untagged)-Kinase deficient mutant (K35M) of Human cyclin-dependent kinase 4 (CDK4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human cyclin-dependent kinase 4 (CDK4), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CDK4 mouse monoclonal antibody, clone IML-4, Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CDK4 (untagged)-Kinase deficient mutant (K35M) of Human cyclin-dependent kinase 4 (CDK4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CDK4 (untagged)-Kinase deficient mutant (K35M) of Human cyclin-dependent kinase 4 (CDK4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CDK4 (1-303, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-CDK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK4 antibody: synthetic peptide directed towards the C terminal of human CDK4. Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Mouse Monoclonal CDK4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal CDK4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CDK4 (1-303, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CDK4 MS Standard C13 and N15-labeled recombinant protein (NP_000066)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of CDK4 (NM_000075) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDK4 (NM_000075) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDK4 (NM_000075) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CDK4
Pathways
- Pathways in cancer