Products

cDNA Clones (14)
Proteins (7)
Antibodies (2)
Jump to Filters
View as table Download
SRP72 (NM_006947) Human Tagged ORF Clone
RC214727

USD 750.00

In Stock

SRP72 (Myc-DDK-tagged)-Human signal recognition particle 72kDa (SRP72)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SRP72 (NM_006947) Human Tagged ORF Clone Lentiviral Particle
RC214727L1V

USD 1,150.00

3 Weeks

Lenti ORF particles, SRP72 (Myc-DDK tagged) - Human signal recognition particle 72kDa (SRP72), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SRP72 (NM_006947) Human Tagged ORF Clone Lentiviral Particle
RC214727L2V

USD 1,150.00

6 Weeks

Lenti ORF particles, SRP72 (mGFP-tagged) - Human signal recognition particle 72kDa (SRP72), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SRP72 (NM_006947) Human Tagged ORF Clone
RG214727

USD 830.00

In Stock

SRP72 (GFP-tagged) - Human signal recognition particle 72kDa (SRP72)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SRP72 (NM_006947) Human Tagged ORF Clone
RC214727L3

USD 950.00

3 Weeks

Lenti ORF clone of Human signal recognition particle 72kDa (SRP72), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SRP72 (NM_006947) Human Tagged ORF Clone Lentiviral Particle
RC214727L3V

USD 1,150.00

5 Weeks

Lenti ORF particles, SRP72 (Myc-DDK tagged) - Human signal recognition particle 72kDa (SRP72), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SRP72 (NM_006947) Human Tagged ORF Clone
RC214727L4

USD 950.00

3 Weeks

Lenti ORF clone of Human signal recognition particle 72kDa (SRP72), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SRP72 (NM_006947) Human Tagged ORF Clone Lentiviral Particle
RC214727L4V

USD 1,150.00

7 Weeks

Lenti ORF particles, SRP72 (mGFP-tagged) - Human signal recognition particle 72kDa (SRP72), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SRP72 (NM_001267722) Human Tagged ORF Clone
RC234559

USD 480.00

5 Weeks

SRP72 (Myc-DDK tagged) - Homo sapiens signal recognition particle 72kDa (SRP72), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SRP72 (NM_001267722) Human Tagged ORF Clone
RG234559

USD 530.00

5 Weeks

SRP72 (GFP-tagged) - Homo sapiens signal recognition particle 72kDa (SRP72), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SRP72 (NM_006947) Human Tagged ORF Clone
RC214727L1

USD 1,176.00

In Stock

Lenti ORF clone of Human signal recognition particle 72kDa (SRP72), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SRP72 (Center) Rabbit Polyclonal Antibody
AP17766PU-N

USD 450.00

2 Weeks

SRP72 (Center) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 126~156 amino acids from the Center region of Human SRP72
SRP72 (NM_006947) Human Tagged ORF Clone
RC214727L2

USD 950.00

3 Weeks

Lenti ORF clone of Human signal recognition particle 72kDa (SRP72), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SRP72 (NM_006947) Human Untagged Clone
SC115795

USD 1,370.00

In Stock

SRP72 (untagged)-Human signal recognition particle 72kDa (SRP72)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SRP72 Rabbit Polyclonal Antibody
TA330406

USD 375.00

5 Days

Rabbit Polyclonal Anti-SRP72 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP72 antibody: synthetic peptide directed towards the middle region of human SRP72. Synthetic peptide located within the following region: GDSQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRG
SRP72 (NM_006947) Human Over-expression Lysate
LC416310

USD 187.00

2 Weeks

SRP72 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SRP72 (NM_006947) Human Over-expression Lysate
LY416310

USD 605.00

5 Days

Transient overexpression lysate of signal recognition particle 72kDa (SRP72)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SRP72 (NM_001267722) Human Untagged Clone
SC332875

USD 630.00

5 Weeks

SRP72 (untagged) - Homo sapiens signal recognition particle 72kDa (SRP72), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SRP72 ICC Control Block
TB414727

USD 1,400.00

4 Weeks

Transient overexpression of SRP72 (NM_006947) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SRP72 ICC Control Block
TB434559

USD 1,130.00

4 Weeks

Transient overexpression of SRP72 (NM_001267722) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SRP72 Cytosection
TS414727

USD 225.00

4 Weeks

Transient overexpression of SRP72 (NM_006947) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SRP72 Cytosection
TS414727P5

USD 889.00

4 Weeks

Transient overexpression of SRP72 (NM_006947) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SRP72 ICC Control Sections
TS434559P5

USD 889.00

4 Weeks

Transient overexpression of SRP72 (NM_001267722) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack