Products

cDNA Clones (32)
Proteins (15)
Antibodies (2)
Jump to Filters
View as table Download
GART (NM_175085) Human Tagged ORF Clone
RC220898

USD 420.00

In Stock

GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GART (NM_175085) Human Tagged ORF Clone Lentiviral Particle
RC220898L1V

USD 820.00

3 Weeks

Lenti ORF particles, GART (Myc-DDK tagged) - Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GART (NM_175085) Human Tagged ORF Clone Lentiviral Particle
RC220898L2V

USD 820.00

6 Weeks

Lenti ORF particles, GART (mGFP-tagged) - Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GART (NM_000819) Human Tagged ORF Clone
RC210447

USD 600.00

In Stock

GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GART (NM_001136005) Human Tagged ORF Clone
RC226553

USD 600.00

In Stock

GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GART (NM_001136006) Human Tagged ORF Clone
RC226662

USD 600.00

In Stock

GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GART (NM_000819) Human Tagged ORF Clone
RC210447L3

USD 800.00

3 Weeks

Lenti-ORF clone of GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_000819) Human Tagged ORF Clone Lentiviral Particle
RC210447L3V

USD 1,000.00

6 Weeks

Lenti ORF particles, GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_000819) Human Tagged ORF Clone
RC210447L4

USD 800.00

3 Weeks

Lenti-ORF clone of GART (mGFP-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_000819) Human Tagged ORF Clone Lentiviral Particle
RC210447L4V

USD 1,000.00

6 Weeks

Lenti ORF particles, GART (mGFP-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_175085) Human Tagged ORF Clone
RC220898L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_175085) Human Tagged ORF Clone Lentiviral Particle
RC220898L3V

USD 820.00

6 Weeks

Lenti ORF particles, GART (Myc-DDK tagged) - Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_175085) Human Tagged ORF Clone
RC220898L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_175085) Human Tagged ORF Clone Lentiviral Particle
RC220898L4V

USD 820.00

6 Weeks

Lenti ORF particles, GART (mGFP-tagged) - Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_001136005) Human Tagged ORF Clone
RC226553L3

USD 800.00

3 Weeks

Lenti-ORF clone of GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_001136005) Human Tagged ORF Clone Lentiviral Particle
RC226553L3V

USD 1,000.00

6 Weeks

Lenti ORF particles, GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_001136005) Human Tagged ORF Clone
RC226553L4

USD 800.00

3 Weeks

Lenti-ORF clone of GART (mGFP-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_001136005) Human Tagged ORF Clone Lentiviral Particle
RC226553L4V

USD 1,000.00

6 Weeks

Lenti ORF particles, GART (mGFP-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_001136006) Human Tagged ORF Clone
RC226662L3

USD 800.00

3 Weeks

Lenti-ORF clone of GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_001136006) Human Tagged ORF Clone Lentiviral Particle
RC226662L3V

USD 1,000.00

6 Weeks

Lenti ORF particles, GART (Myc-DDK-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_001136006) Human Tagged ORF Clone
RC226662L4

USD 800.00

3 Weeks

Lenti-ORF clone of GART (mGFP-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_001136006) Human Tagged ORF Clone Lentiviral Particle
RC226662L4V

USD 1,000.00

6 Weeks

Lenti ORF particles, GART (mGFP-tagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GART (NM_000819) Human Tagged ORF Clone
RG210447

USD 660.00

3 Weeks

GART (GFP-tagged) - Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GART (NM_175085) Human Tagged ORF Clone
RG220898

USD 460.00

3 Weeks

GART (GFP-tagged) - Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GART (NM_001136005) Human Tagged ORF Clone
RG226553

USD 660.00

3 Weeks

GART (GFP-tagged) - Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GART (NM_001136006) Human Tagged ORF Clone
RG226662

USD 660.00

3 Weeks

GART (GFP-tagged) - Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GART (NM_175085) Human Tagged ORF Clone
RC220898L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GART Mouse Monoclonal Antibody [Clone ID: 4D6-1D5]
AM20886PU-N

USD 480.00

2 Weeks

GART mouse monoclonal antibody, clone 4D6-1D5

Applications ELISA, IF, IHC, WB
Reactivities Human
GART (NM_000819) Human Untagged Clone
SC119632

USD 1,100.00

In Stock

GART (untagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GART (NM_175085) Human Tagged ORF Clone
RC220898L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GART Rabbit Polyclonal Antibody
TA338360

USD 375.00

5 Days

Rabbit Polyclonal Anti-GART Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GART antibody: synthetic peptide directed towards the middle region of human GART. Synthetic peptide located within the following region: VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV
GART (NM_175085) Human Over-expression Lysate
LC406318

USD 187.00

2 Weeks

GART HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GART (NM_175085) Human Over-expression Lysate
LY406318

USD 605.00

5 Days

Transient overexpression lysate of phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GART (NM_175085) Human Mass Spec Standard
PH320898

USD 2,055.00

3 Weeks

GART MS Standard C13 and N15-labeled recombinant protein (NP_780294)

Tag C-Myc/DDK
Expression Host HEK293
GART (NM_175085) Human Untagged Clone
SC313442

USD 730.00

3 Weeks

GART (untagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GART (NM_001136005) Human Untagged Clone
SC325384

USD 2,040.00

6 Weeks

GART (untagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 3

Vector pCMV6 series
Tag Tag Free
GART (NM_001136006) Human Untagged Clone
SC325385

USD 1,100.00

6 Weeks

GART (untagged)-Human phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase (GART), transcript variant 4

Vector pCMV6 series
Tag Tag Free
GART ICC Control Block
TB410447

USD 1,250.00

4 Weeks

Transient overexpression of GART (NM_000819) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GART ICC Control Block
TB420898

USD 1,070.00

4 Weeks

Transient overexpression of GART (NM_175085) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GART ICC Control Block
TB426553

USD 1,250.00

4 Weeks

Transient overexpression of GART (NM_001136005) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GART ICC Control Block
TB426662

USD 1,250.00

4 Weeks

Transient overexpression of GART (NM_001136006) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GART Cytosection
TS410447

USD 225.00

4 Weeks

Transient overexpression of GART (NM_000819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GART Cytosection
TS410447P5

USD 889.00

4 Weeks

Transient overexpression of GART (NM_000819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GART Cytosection
TS420898

USD 225.00

4 Weeks

Transient overexpression of GART (NM_175085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GART Cytosection
TS420898P5

USD 889.00

4 Weeks

Transient overexpression of GART (NM_175085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GART Cytosection
TS426553

USD 225.00

4 Weeks

Transient overexpression of GART (NM_001136005) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GART Cytosection
TS426553P5

USD 889.00

4 Weeks

Transient overexpression of GART (NM_001136005) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GART Cytosection
TS426662

USD 225.00

4 Weeks

Transient overexpression of GART (NM_001136006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GART Cytosection
TS426662P5

USD 889.00

4 Weeks

Transient overexpression of GART (NM_001136006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack