Products

View as table Download

GMPR2 (Myc-DDK-tagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GMPR2 (Myc-DDK-tagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GMPR2 (Myc-DDK-tagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GMPR2 (Myc-DDK-tagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPR2 (Myc-DDK tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPR2 (mGFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPR2 (Myc-DDK tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPR2 (mGFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPR2 (Myc-DDK tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPR2 (mGFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPR2 (Myc-DDK tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPR2 (mGFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GMPR2 (myc-DDK-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GMPR2 (myc-DDK-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GMPR2 (myc-DDK-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-GMPR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GMPR2 antibody: synthetic peptide directed towards the C terminal of human GMPR2. Synthetic peptide located within the following region: GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV

GMPR2 (untagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

GMPR2 (untagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

GMP reductase 2 / GMPR2 (1-348, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

GMP reductase 2 / GMPR2 (1-348, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY424316 is the same product as LY425067.

Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000)

Tag C-Myc/DDK
Expression Host HEK293

GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660)

Tag C-Myc/DDK
Expression Host HEK293

GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001)

Tag C-Myc/DDK
Expression Host HEK293

GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002)

Tag C-Myc/DDK
Expression Host HEK293

GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®