GMPR2 (Myc-DDK-tagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GMPR2 (Myc-DDK-tagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GMPR2 (Myc-DDK-tagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GMPR2 (Myc-DDK-tagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GMPR2 (Myc-DDK-tagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GMPR2 (Myc-DDK tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GMPR2 (mGFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GMPR2 (Myc-DDK tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GMPR2 (mGFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GMPR2 (Myc-DDK tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GMPR2 (mGFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GMPR2 (Myc-DDK tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GMPR2 (mGFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GMPR2 (myc-DDK-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GMPR2 (myc-DDK-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GMPR2 (myc-DDK-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GMPR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GMPR2 antibody: synthetic peptide directed towards the C terminal of human GMPR2. Synthetic peptide located within the following region: GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV |
GMPR2 (untagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GMPR2 (untagged)-Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GMP reductase 2 / GMPR2 (1-348, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
GMP reductase 2 / GMPR2 (1-348, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GMPR2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GMPR2 (GFP-tagged) - Human guanosine monophosphate reductase 2 (GMPR2), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |