Products

cDNA Clones (18)
Proteins (16)
Antibodies (7)
Jump to Filters
View as table Download
Lactate Dehydrogenase B (LDHB) (NM_002300) Human Untagged Clone
SC319772

USD 310.00

In Stock

LDHB (untagged)-Human lactate dehydrogenase B (LDHB), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Lactate Dehydrogenase B (LDHB) (NM_002300) Human Tagged ORF Clone
RG205074

USD 460.00

In Stock

LDHB (GFP-tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lactate Dehydrogenase B (LDHB) (NM_002300) Human Tagged ORF Clone Lentiviral Particle
RC205074L3V

USD 820.00

5 Weeks

Lenti ORF particles, LDHB (Myc-DDK tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lactate Dehydrogenase B (LDHB) (NM_002300) Human Tagged ORF Clone Lentiviral Particle
RC205074L4V

USD 820.00

3 Weeks

Lenti ORF particles, LDHB (mGFP-tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lactate Dehydrogenase B (LDHB) (NM_001174097) Human Tagged ORF Clone Lentiviral Particle
RC229903L3V

USD 820.00

6 Weeks

Lenti ORF particles, LDHB (Myc-DDK-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lactate Dehydrogenase B (LDHB) (NM_001174097) Human Tagged ORF Clone Lentiviral Particle
RC229903L4V

USD 820.00

6 Weeks

Lenti ORF particles, LDHB (mGFP-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lactate Dehydrogenase B (LDHB) Rabbit Polyclonal Antibody
TA346572

USD 475.00

5 Days

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
Lactate Dehydrogenase B (LDHB) (NM_002300) Human Over-expression Lysate
LY400836

USD 396.00

2 Weeks

Transient overexpression lysate of lactate dehydrogenase B (LDHB)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LDHB (1-334, His-tag) Human Protein
AR09553PU-L

USD 745.00

2 Weeks

LDHB (1-334, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
LDHB (1-334, His-tag) Human Protein
AR09553PU-N

USD 300.00

2 Weeks

LDHB (1-334, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Lactate Dehydrogenase B (LDHB) (NM_002300) Human Tagged ORF Clone
RC205074L2

USD 620.00

3 Weeks

Lenti ORF clone of Human lactate dehydrogenase B (LDHB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Lactate Dehydrogenase B (LDHB) Goat Polyclonal Antibody
TA329084

USD 375.00

5 Days

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Internal region (near C terminus) (NARGLTSVINQKLK)
LDHB Mouse Monoclonal Antibody [Clone ID: AT14D7]
AM50625PU-N

USD 340.00

2 Weeks

LDHB mouse monoclonal antibody, clone AT14D7, Purified

Applications ELISA, WB
Reactivities Human
LDHB Mouse Monoclonal Antibody [Clone ID: AT14D7]
AM50625PU-S

USD 230.00

2 Weeks

LDHB mouse monoclonal antibody, clone AT14D7, Purified

Applications ELISA, WB
Reactivities Human
Lactate Dehydrogenase B (LDHB) Rabbit Polyclonal Antibody
TA324032

USD 345.00

4 Weeks

Anti-LDHB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide (KLH-coupled) derived from human LDHB
Lactate Dehydrogenase B (LDHB) Goat Polyclonal Antibody
TA327769

USD 375.00

5 Days

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (near N terminus) (EEATVPNNKIT)
Lactate Dehydrogenase B (LDHB) (NM_002300) Human Mass Spec Standard
PH305074

USD 2,055.00

3 Weeks

LDHB MS Standard C13 and N15-labeled recombinant protein (NP_002291)

Tag C-Myc/DDK
Expression Host HEK293
Lactate Dehydrogenase B (LDHB) ICC Control Block
TB405074

USD 1,070.00

4 Weeks

Transient overexpression of LDHB (NM_002300) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lactate Dehydrogenase B (LDHB) ICC Control Block
TB429903

USD 1,070.00

4 Weeks

Transient overexpression of LDHB (NM_001174097) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lactate Dehydrogenase B (LDHB) (NM_001174097) Human Recombinant Protein
TP720210L

USD 1,900.00

3 Weeks

Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.

Tag N-His
Expression Host E. coli
Lactate Dehydrogenase B (LDHB) (NM_001174097) Human Recombinant Protein
TP720210M

USD 760.00

3 Weeks

Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.

Tag N-His
Expression Host E. coli
Lactate Dehydrogenase B (LDHB) (NM_001174097) Human Recombinant Protein
TP720210XL

USD 2,800.00

3 Weeks

Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.

Tag N-His
Expression Host E. coli
Lactate Dehydrogenase B (LDHB) Cytosection
TS405074

USD 225.00

4 Weeks

Transient overexpression of LDHB (NM_002300) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Lactate Dehydrogenase B (LDHB) Cytosection
TS405074P5

USD 889.00

4 Weeks

Transient overexpression of LDHB (NM_002300) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Lactate Dehydrogenase B (LDHB) Cytosection
TS429903

USD 225.00

4 Weeks

Transient overexpression of LDHB (NM_001174097) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Lactate Dehydrogenase B (LDHB) Cytosection
TS429903P5

USD 889.00

4 Weeks

Transient overexpression of LDHB (NM_001174097) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack