LDHB (Myc-DDK-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LDHB (Myc-DDK-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LDHB (untagged)-Human lactate dehydrogenase B (LDHB), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Recombinant protein of human lactate dehydrogenase B (LDHB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, LDHB (Myc-DDK tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, LDHB (mGFP-tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
LDHB (GFP-tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human lactate dehydrogenase B (LDHB), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
LDHB (Myc-DDK-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human lactate dehydrogenase B (LDHB), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, LDHB (Myc-DDK tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, LDHB (mGFP-tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of LDHB (Myc-DDK-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, LDHB (Myc-DDK-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of LDHB (mGFP-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, LDHB (mGFP-tagged)-Human lactate dehydrogenase B (LDHB), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
LDHB (GFP-tagged) - Human lactate dehydrogenase B (LDHB), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-LDHB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
Lenti ORF clone of Human lactate dehydrogenase B (LDHB), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of lactate dehydrogenase B (LDHB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LDHB (1-334, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
LDHB (1-334, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
USD 480.00
2 Weeks
Lactate Dehydrogenase B (LDHB) mouse monoclonal antibody, clone 2H6
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
USD 121.00
In Stock
LDHB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human lactate dehydrogenase B (LDHB), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
LDHB Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Internal region (near C terminus) (NARGLTSVINQKLK) |
LDHB mouse monoclonal antibody, clone AT14D7, Purified
Applications | ELISA, WB |
Reactivities | Human |
LDHB mouse monoclonal antibody, clone AT14D7, Purified
Applications | ELISA, WB |
Reactivities | Human |
Anti-LDHB Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide (KLH-coupled) derived from human LDHB |
LDHB Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | internal region (near N terminus) (EEATVPNNKIT) |
LDHB MS Standard C13 and N15-labeled recombinant protein (NP_002291)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
LDHB (untagged)-Human lactate dehydrogenase B (LDHB) transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of LDHB (NM_002300) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LDHB (NM_001174097) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.
Tag | N-His |
Expression Host | E. coli |
USD 1,900.00
3 Weeks
Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.
Tag | N-His |
Expression Host | E. coli |
USD 760.00
3 Weeks
Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.
Tag | N-His |
Expression Host | E. coli |
USD 2,800.00
3 Weeks
Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2.
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of LDHB (NM_002300) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LDHB (NM_002300) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of LDHB (NM_001174097) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LDHB (NM_001174097) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack