Products

cDNA Clones (25)
Proteins (10)
Antibodies (3)
Jump to Filters
View as table Download
ME3 (NM_006680) Human Tagged ORF Clone Lentiviral Particle
RC224151L1V

USD 820.00

2 Weeks

Lenti ORF particles, ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ME3 (NM_006680) Human Tagged ORF Clone Lentiviral Particle
RC224151L2V

USD 820.00

6 Weeks

Lenti ORF particles, ME3 (mGFP-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ME3 (NM_006680) Human Tagged ORF Clone
RC224151

USD 420.00

In Stock

ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ME3 (NM_006680) Human Tagged ORF Clone
RG224151

USD 460.00

In Stock

ME3 (GFP-tagged) - Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ME3 (NM_001014811) Human Tagged ORF Clone
RC205265

USD 420.00

2 Weeks

ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ME3 (NM_001014811) Human Tagged ORF Clone
RG205265

USD 460.00

In Stock

ME3 (GFP-tagged) - Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ME3 (NM_001014811) Human Tagged ORF Clone
RC205265L3

USD 620.00

3 Weeks

Lenti-ORF clone of ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_001014811) Human Tagged ORF Clone Lentiviral Particle
RC205265L3V

USD 820.00

6 Weeks

Lenti ORF particles, ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_001014811) Human Tagged ORF Clone
RC205265L4

USD 620.00

3 Weeks

Lenti-ORF clone of ME3 (mGFP-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_001014811) Human Tagged ORF Clone Lentiviral Particle
RC205265L4V

USD 820.00

6 Weeks

Lenti ORF particles, ME3 (mGFP-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_006680) Human Tagged ORF Clone
RC224151L3

USD 620.00

3 Weeks

Lenti-ORF clone of ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_006680) Human Tagged ORF Clone Lentiviral Particle
RC224151L3V

USD 820.00

6 Weeks

Lenti ORF particles, ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_006680) Human Tagged ORF Clone
RC224151L4

USD 620.00

3 Weeks

Lenti-ORF clone of ME3 (mGFP-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_006680) Human Tagged ORF Clone Lentiviral Particle
RC224151L4V

USD 820.00

6 Weeks

Lenti ORF particles, ME3 (mGFP-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_001161586) Human Tagged ORF Clone
RC228973

USD 420.00

4 Weeks

ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ME3 (NM_001161586) Human Tagged ORF Clone
RC228973L3

USD 620.00

4 Weeks

Lenti-ORF clone of ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_001161586) Human Tagged ORF Clone Lentiviral Particle
RC228973L3V

USD 820.00

7 Weeks

Lenti ORF particles, ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_001161586) Human Tagged ORF Clone
RC228973L4

USD 620.00

4 Weeks

Lenti-ORF clone of ME3 (mGFP-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_001161586) Human Tagged ORF Clone Lentiviral Particle
RC228973L4V

USD 820.00

7 Weeks

Lenti ORF particles, ME3 (mGFP-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ME3 (NM_001161586) Human Tagged ORF Clone
RG228973

USD 460.00

5 Weeks

ME3 (GFP-tagged) - Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ME3 (NM_006680) Human Tagged Lenti ORF Clone
RC224151L1

USD 768.00

In Stock

Lenti-ORF clone of ME3 (Myc-DDK-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ME3 (NM_006680) Human Untagged Clone
SC115951

USD 310.00

In Stock

ME3 (untagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ME3 Rabbit Polyclonal Antibody
TA346684

USD 475.00

5 Days

Rabbit Polyclonal Anti-ME3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ME3 antibody: synthetic peptide directed towards the N terminal of human ME3. Synthetic peptide located within the following region: PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD
ME3 (NM_006680) Human Tagged ORF Clone
RC224151L2

USD 620.00

3 Weeks

Lenti-ORF clone of ME3 (mGFP-tagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ME3 (NM_001014811) Human Untagged Clone
SC301958

USD 760.00

In Stock

ME3 (untagged)-Human malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ME3 Rabbit Polyclonal Antibody
AP21077PU-N

USD 407.00

2 Weeks

ME3 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
ME3 Rabbit Polyclonal Antibody
TA315116

USD 345.00

4 Weeks

Rabbit polyclonal anti-ME3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ME3.
ME3 (NM_001014811) Human Over-expression Lysate
LY423083

USD 396.00

5 Days

Transient overexpression lysate of malic enzyme 3, NADP(+)-dependent, mitochondrial (ME3), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ME3 (NM_001014811) Human Over-expression Lysate
LC423083

USD 121.00

2 Weeks

ME3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ME3 (NM_001161586) Human Untagged Clone
SC327608

USD 760.00

5 Weeks

ME3 (untagged)-Human malic enzyme 3 NADP(+)-dependent mitochondrial (ME3) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ME3 ICC Control Block
TB405265

USD 1,070.00

4 Weeks

Transient overexpression of ME3 (NM_001014811) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ME3 (NM_006680) ICC Control Block
TB424151

USD 1,070.00

4 Weeks

Transient overexpression of ME3 (NM_006680) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ME3 (NM_001161586) ICC Control Block
TB428973

USD 1,070.00

4 Weeks

Transient overexpression of ME3 (NM_001161586) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ME3 Cytosection
TS405265

USD 225.00

10 Weeks

Transient overexpression of ME3 (NM_001014811) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ME3 Cytosection
TS405265P5

USD 889.00

4 Weeks

Transient overexpression of ME3 (NM_001014811) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ME3 Cytosection
TS424151

USD 225.00

4 Weeks

Transient overexpression of ME3 (NM_006680) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ME3 Cytosection
TS424151P5

USD 889.00

4 Weeks

Transient overexpression of ME3 (NM_006680) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ME3 ICC Control Sections
TS428973P5

USD 889.00

4 Weeks

Transient overexpression of ME3 (NM_001161586) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack