Products

cDNA Clones (30)
Proteins (17)
Antibodies (7)
Jump to Filters
View as table Download
PCB (PC) (NM_000920) Human Tagged ORF Clone
RC221895

USD 1,010.00

In Stock

PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PCB (PC) (NM_001040716) Human Tagged ORF Clone
RC221952

USD 1,010.00

In Stock

PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PCB (PC) (NM_000920) Human Tagged ORF Clone Lentiviral Particle
RC221895L1V

USD 1,410.00

3 Weeks

Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PCB (PC) (NM_000920) Human Tagged ORF Clone Lentiviral Particle
RC221895L2V

USD 1,410.00

6 Weeks

Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PCB (PC) (NM_001040716) Human Tagged ORF Clone Lentiviral Particle
RC221952L1V

USD 1,410.00

6 Weeks

Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PCB (PC) (NM_001040716) Human Tagged ORF Clone Lentiviral Particle
RC221952L2V

USD 1,410.00

6 Weeks

Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PCB (PC) (NM_022172) Human Tagged ORF Clone
RC202481

USD 1,010.00

In Stock

PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCB (PC) (NM_000920) Human Tagged ORF Clone
RG221895

USD 1,110.00

In Stock

PC (GFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCB (PC) (NM_000920) Human Untagged Clone
SC122580

USD 310.00

In Stock

PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PCB (PC) (NM_022172) Human Tagged ORF Clone
RC202481L3

USD 1,210.00

3 Weeks

Lenti-ORF clone of PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_022172) Human Tagged ORF Clone Lentiviral Particle
RC202481L3V

USD 1,410.00

6 Weeks

Lenti ORF particles, PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_022172) Human Tagged ORF Clone
RC202481L4

USD 1,210.00

3 Weeks

Lenti-ORF clone of PC (mGFP-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_022172) Human Tagged ORF Clone Lentiviral Particle
RC202481L4V

USD 1,410.00

6 Weeks

Lenti ORF particles, PC (mGFP-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_000920) Human Tagged ORF Clone
RC221895L3

USD 1,210.00

3 Weeks

Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_000920) Human Tagged ORF Clone Lentiviral Particle
RC221895L3V

USD 1,410.00

5 Weeks

Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_000920) Human Tagged ORF Clone
RC221895L4

USD 1,210.00

3 Weeks

Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_000920) Human Tagged ORF Clone Lentiviral Particle
RC221895L4V

USD 1,410.00

7 Weeks

Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_001040716) Human Tagged ORF Clone
RC221952L3

USD 1,210.00

3 Weeks

Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_001040716) Human Tagged ORF Clone Lentiviral Particle
RC221952L3V

USD 1,410.00

6 Weeks

Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_001040716) Human Tagged ORF Clone
RC221952L4

USD 1,210.00

3 Weeks

Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_001040716) Human Tagged ORF Clone Lentiviral Particle
RC221952L4V

USD 1,410.00

6 Weeks

Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCB (PC) (NM_022172) Human Tagged ORF Clone
RG202481

USD 1,110.00

3 Weeks

PC (GFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCB (PC) (NM_001040716) Human Tagged ORF Clone
RG221952

USD 1,110.00

3 Weeks

PC (GFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCB (PC) (NM_000920) Human Tagged ORF Clone
RC221895L1

USD 1,500.00

In Stock

Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PCB (PC) Rabbit Polyclonal Antibody
TA309794

USD 424.00

5 Days

Rabbit Polyclonal Pyruvate Carboxylase Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498]
PCB (PC) Rabbit Polyclonal Antibody
TA326111

USD 345.00

In Stock

Rabbit polyclonal PC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PC.
PCB (PC) (NM_000920) Human Over-expression Lysate
LC400340

USD 121.00

In Stock

PC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PCB (PC) (NM_000920) Human Over-expression Lysate
LY400340

USD 396.00

5 Days

Transient overexpression lysate of pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PCB (PC) (NM_000920) Human Tagged ORF Clone
RC221895L2

USD 1,210.00

3 Weeks

Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PCB (PC) (NM_001040716) Human Tagged ORF Clone
RC221952L1

USD 1,210.00

3 Weeks

Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PCB (PC) (NM_001040716) Human Tagged ORF Clone
RC221952L2

USD 1,210.00

3 Weeks

Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PCB (PC) (N-term) Rabbit Polyclonal Antibody
AP53186PU-N

USD 450.00

2 Weeks

PCB (PC) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 52-82 amino acids from the N-terminal region of human PC
PCB (PC) (NM_022172) Human Untagged Clone
SC320313

USD 2,380.00

In Stock

PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PCB (PC) Goat Polyclonal Antibody
TA302584

USD 375.00

5 Days

Goat Polyclonal Antibody against Pyruvate Carboxylase

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-KFKEVKKAYVEANQ, from the internal region of the protein sequence according to NP_000911.2; NP_001035806.1; NP_071504.2.
PCB (PC) Rabbit Polyclonal Antibody
TA342671

USD 375.00

5 Days

Rabbit Polyclonal Anti-PC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PC antibody: synthetic peptide directed towards the C terminal of human PC. Synthetic peptide located within the following region: SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL
PCB (PC) (NM_001040716) Human Over-expression Lysate
LC420837

USD 187.00

2 Weeks

PC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PCB (PC) (NM_001040716) Human Over-expression Lysate
LC425729

USD 187.00

2 Weeks

PC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PCB (PC) (NM_001040716) Human Over-expression Lysate
LY420837

USD 605.00

5 Days

Transient overexpression lysate of pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY420837 is the same product as LY425729.
PCB (PC) (NM_001040716) Human Over-expression Lysate
LY425729

USD 605.00

5 Days

Transient overexpression lysate of pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PCB (PC) (NM_000920) Human Mass Spec Standard
PH321895

USD 2,055.00

3 Weeks

PC MS Standard C13 and N15-labeled recombinant protein (NP_000911)

Tag C-Myc/DDK
Expression Host HEK293
PCB (PC) (NM_001040716) Human Mass Spec Standard
PH321952

USD 2,055.00

3 Weeks

PC MS Standard C13 and N15-labeled recombinant protein (NP_001035806)

Tag C-Myc/DDK
Expression Host HEK293
PCB (PC) (NM_022172) Human Untagged Clone
SC305013

USD 2,380.00

6 Weeks

PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6 series
Tag Tag Free
PCB (PC) (NM_001040716) Human Untagged Clone
SC311133

USD 1,000.00

3 Weeks

PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PCB (PC) Rabbit Polyclonal Antibody
TA321239

USD 345.00

In Stock

Anti-PC Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase
PCB (PC) Rabbit Polyclonal Antibody
TA321240

USD 345.00

In Stock

Anti-PC Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase
PCB (PC) ICC Control Block
TB402481

USD 1,660.00

4 Weeks

Transient overexpression of PC (NM_022172) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PCB (PC) ICC Control Block
TB421895

USD 1,660.00

4 Weeks

Transient overexpression of PC (NM_000920) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PCB (PC) ICC Control Block
TB421952

USD 1,660.00

4 Weeks

Transient overexpression of PC (NM_001040716) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PCB (PC) Cytosection
TS402481

USD 225.00

4 Weeks

Transient overexpression of PC (NM_022172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PCB (PC) Cytosection
TS402481P5

USD 889.00

4 Weeks

Transient overexpression of PC (NM_022172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack