Germany
Japan
United Kingdom
China
TRAF6 (Myc-DDK-tagged)-Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
TRAF6 (Myc-DDK-tagged)-Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
TRAF6 (untagged)-Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TRAF6 (GFP-tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TRAF6 (untagged)-Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, TRAF6 (Myc-DDK tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TRAF6 (Myc-DDK tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TRAF6 (mGFP-tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, TRAF6 (mGFP-tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TRAF6 (Myc-DDK tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, TRAF6 (mGFP-tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, TRAF6 (Myc-DDK tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TRAF6 (mGFP-tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TRAF6 (GFP-tagged) - Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human TNF receptor-associated factor 6 (TRAF6), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TRAF6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of TNF receptor-associated factor 6 (TRAF6), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human TNF receptor-associated factor 6 (TRAF6), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression of TRAF6 (NM_004620) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
TRAF6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal TRAF-6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 451-469 (DAKPELLAFQRPTIPRNPK) of human TRAF6 was used as immunogen, GenBank no. NP_665802.1. |
TRAF6 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 436 of rat TRAF6 |
Transient overexpression lysate of TNF receptor-associated factor 6 (TRAF6), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal anti-TRAF6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAF6 antibody: synthetic peptide directed towards the middle region of human TRAF6. Synthetic peptide located within the following region: YVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV |
Rabbit Polyclonal Anti-TRAF6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRAF6 antibody is: synthetic peptide directed towards the C-terminal region of Human TRAF6. Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA |
Rabbit Polyclonal TRAF-6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Anti-TRAF6 polyclonal antibody was raised against a peptide corresponding to amino acids between 410 and 460 of human TRAF6. |
TRAF6 MS Standard C13 and N15-labeled recombinant protein (NP_004611)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-TRAF6 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 350-522 amino acids of human TNF receptor-associated factor 6, E3 ubiquitin protein ligase |
Transient overexpression of TRAF6 (NM_145803) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TRAF6 (NM_004620) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TRAF6 (NM_145803) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TRAF6 (NM_145803) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TRAF6 (NM_004620) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- TRAF6
Pathways
- RIG-I-like receptor signaling pathway