Products

cDNA Clones (24)
Proteins (15)
Antibodies (8)
Jump to Filters
View as table Download
DCP1A (NM_018403) Human Tagged ORF Clone
RC201330

USD 540.00

In Stock

DCP1A (Myc-DDK-tagged)-Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DCP1A (NM_018403) Human Tagged ORF Clone Lentiviral Particle
RC201330L1V

USD 940.00

3 Weeks

Lenti ORF particles, DCP1A (Myc-DDK tagged) - Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
DCP1A (NM_018403) Human Tagged ORF Clone Lentiviral Particle
RC201330L2V

USD 940.00

6 Weeks

Lenti ORF particles, DCP1A (mGFP-tagged) - Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
DCP1A (NM_018403) Human Tagged ORF Clone
RG201330

USD 590.00

In Stock

DCP1A (GFP-tagged) - Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP1A (NM_018403) Human Tagged ORF Clone Lentiviral Particle
RC201330L3V

USD 940.00

5 Weeks

Lenti ORF particles, DCP1A (Myc-DDK tagged) - Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DCP1A (NM_018403) Human Tagged ORF Clone Lentiviral Particle
RC201330L4V

USD 940.00

3 Weeks

Lenti ORF particles, DCP1A (mGFP-tagged) - Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DCP1A (NM_001290207) Human Tagged ORF Clone
RC238139

USD 420.00

2 Weeks

DCP1A (myc-DDK-tagged) - Human decapping mRNA 1A (DCP1A), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP1A (NM_001290206) Human Tagged ORF Clone
RC238356

USD 480.00

2 Weeks

DCP1A (myc-DDK-tagged) - Human decapping mRNA 1A (DCP1A), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP1A (NM_001290205) Human Tagged ORF Clone
RC238638

USD 480.00

3 Weeks

DCP1A (myc-DDK-tagged) - Human decapping mRNA 1A (DCP1A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP1A (NM_001290204) Human Tagged ORF Clone
RC238825

USD 480.00

3 Weeks

DCP1A (myc-DDK-tagged) - Human decapping mRNA 1A (DCP1A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP1A (NM_018403) Human Tagged ORF Clone
RC201330L1

USD 912.00

In Stock

Lenti ORF clone of Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DCP1A (NM_018403) Human Over-expression Lysate
LY413075

USD 396.00

In Stock

Transient overexpression lysate of DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DCP1A Rabbit Polyclonal Antibody
TA345251

USD 410.00

5 Days

Rabbit Polyclonal Anti-DCP1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI
DCP1A Rabbit Polyclonal Antibody
TA347656

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-DCP1A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP1A Antibody: A synthesized peptide derived from human DCP1A
DCP1A (NM_018403) Human Tagged ORF Clone
RC201330L2

USD 740.00

3 Weeks

Lenti ORF clone of Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DCP1A Rabbit Polyclonal Antibody
TA326292

USD 345.00

In Stock

Rabbit polyclonal DCP1A antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DCP1A.
DCP1A Rabbit Polyclonal Antibody
AP06755PU-N

USD 407.00

2 Weeks

DCP1A rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 102-150 of Human SMIF.
DCP1A (NM_018403) Human Over-expression Lysate
LC413075

USD 121.00

In Stock

DCP1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DCP1A (NM_018403) Human Untagged Clone
SC319488

USD 980.00

In Stock

DCP1A (untagged)-Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
DCP1A Goat Polyclonal Antibody
TA303086

USD 375.00

5 Days

Goat Polyclonal Antibody against DCP1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVLTKNKDNHN, from the C Terminus of the protein sequence according to NP_060873.3.
DCP1A Rabbit Polyclonal Antibody
TA310147

USD 230.00

3 Weeks

Rabbit anti-Dcp1a polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
DCP1A Rabbit Polyclonal Antibody
TA337231

USD 310.00

5 Days

Rabbit Polyclonal Anti-DCP1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: EEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGD
DCP1A (NM_018403) Human Mass Spec Standard
PH301330

USD 2,055.00

3 Weeks

DCP1A MS Standard C13 and N15-labeled recombinant protein (NP_060873)

Tag C-Myc/DDK
Expression Host HEK293
DCP1A (NM_001290207) Human Tagged ORF Clone
RG238139

USD 460.00

2 Weeks

DCP1A (GFP-tagged) - Human decapping mRNA 1A (DCP1A), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP1A (NM_001290206) Human Tagged ORF Clone
RG238356

USD 520.00

2 Weeks

DCP1A (GFP-tagged) - Human decapping mRNA 1A (DCP1A), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP1A (NM_001290205) Human Tagged ORF Clone
RG238638

USD 520.00

2 Weeks

DCP1A (GFP-tagged) - Human decapping mRNA 1A (DCP1A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP1A (NM_001290204) Human Tagged ORF Clone
RG238825

USD 520.00

2 Weeks

DCP1A (GFP-tagged) - Human decapping mRNA 1A (DCP1A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DCP1A (NM_018403) Human Untagged Clone
SC318001

USD 980.00

3 Weeks

DCP1A (untagged)-Human DCP1 decapping enzyme homolog A (S. cerevisiae) (DCP1A)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
DCP1A (NM_001290207) Human Untagged Clone
SC336033

USD 420.00

2 Weeks

DCP1A (untagged) - Human decapping mRNA 1A (DCP1A), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
DCP1A (NM_001290206) Human Untagged Clone
SC336250

USD 470.00

2 Weeks

DCP1A (untagged) - Human decapping mRNA 1A (DCP1A), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
DCP1A (NM_001290205) Human Untagged Clone
SC336532

USD 520.00

3 Weeks

DCP1A (untagged) - Human decapping mRNA 1A (DCP1A), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
DCP1A (NM_001290204) Human Untagged Clone
SC336719

USD 550.00

3 Weeks

DCP1A (untagged) - Human decapping mRNA 1A (DCP1A), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
DCP1A Rabbit Polyclonal Antibody
TA349871

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-DCP1A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DCP1A
DCP1A (NM_018403) ICC Control Block
TB401330

USD 1,190.00

4 Weeks

Transient overexpression of DCP1A (NM_018403) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DCP1A (NM_001290207) ICC Control Block
TB438139

USD 1,070.00

4 Weeks

Transient overexpression of DCP1A (NM_001290207) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DCP1A (NM_001290206) ICC Control Block
TB438356

USD 1,130.00

4 Weeks

Transient overexpression of DCP1A (NM_001290206) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DCP1A (NM_001290205) ICC Control Block
TB438638

USD 1,130.00

4 Weeks

Transient overexpression of DCP1A (NM_001290205) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DCP1A (NM_001290204) ICC Control Block
TB438825

USD 1,130.00

4 Weeks

Transient overexpression of DCP1A (NM_001290204) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DCP1A Cytosection
TS401330

USD 225.00

4 Weeks

Transient overexpression of DCP1A (NM_018403) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DCP1A Cytosection
TS401330P5

USD 889.00

4 Weeks

Transient overexpression of DCP1A (NM_018403) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DCP1A ICC Control Sections
TS438139P5

USD 889.00

4 Weeks

Transient overexpression of DCP1A (NM_001290207) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DCP1A ICC Control Sections
TS438356P5

USD 889.00

4 Weeks

Transient overexpression of DCP1A (NM_001290206) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DCP1A ICC Control Sections
TS438638P5

USD 889.00

4 Weeks

Transient overexpression of DCP1A (NM_001290205) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DCP1A ICC Control Sections
TS438825P5

USD 889.00

4 Weeks

Transient overexpression of DCP1A (NM_001290204) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack