Germany
Japan
United Kingdom
China
ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ARHGEF1 (Myc-DDK tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ARHGEF1 (mGFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-ARHGEF1 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARHGEF1. |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ARHGEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG |
ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ARHGEF1 MS Standard C13 and N15-labeled recombinant protein (NP_945353)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ARHGEF1 Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARHGEF1 |
Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARHGEF1 (NM_004706) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ARHGEF1 (NM_004706) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ARHGEF1
Pathways
- Regulation of actin cytoskeleton