Products

View as table Download

ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARHGEF1 (Myc-DDK tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ARHGEF1 (mGFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal anti-ARHGEF1 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARHGEF1.

ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-ARHGEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG

ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ARHGEF1 MS Standard C13 and N15-labeled recombinant protein (NP_945353)

Tag C-Myc/DDK
Expression Host HEK293

ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-ARHGEF1 Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARHGEF1

Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ARHGEF1 (NM_004706) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ARHGEF1 (NM_004706) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack