ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ARHGEF1 (Myc-DDK tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ARHGEF1 (mGFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-ARHGEF1 antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARHGEF1. |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ARHGEF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG |
ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ARHGEF1 MS Standard C13 and N15-labeled recombinant protein (NP_945353)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ARHGEF1 Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARHGEF1 |
Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARHGEF1 (NM_004706) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ARHGEF1 (NM_004706) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack