Products

cDNA Clones (11)
Proteins (5)
Antibodies (4)
Jump to Filters
View as table Download
ATG4D (NM_032885) Human Tagged ORF Clone
RC209627

USD 420.00

In Stock

ATG4D (Myc-DDK-tagged)-Human ATG4 autophagy related 4 homolog D (S. cerevisiae) (ATG4D)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATG4D (NM_032885) Human Tagged ORF Clone
RC209627L3

USD 620.00

3 Weeks

Lenti-ORF clone of ATG4D (Myc-DDK-tagged)-Human ATG4 autophagy related 4 homolog D (S. cerevisiae) (ATG4D)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATG4D (NM_032885) Human Tagged ORF Clone Lentiviral Particle
RC209627L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATG4D (Myc-DDK-tagged)-Human ATG4 autophagy related 4 homolog D (S. cerevisiae) (ATG4D), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATG4D (NM_032885) Human Tagged ORF Clone
RC209627L4

USD 620.00

3 Weeks

Lenti-ORF clone of ATG4D (mGFP-tagged)-Human ATG4 autophagy related 4 homolog D (S. cerevisiae) (ATG4D)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATG4D (NM_032885) Human Tagged ORF Clone Lentiviral Particle
RC209627L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATG4D (mGFP-tagged)-Human ATG4 autophagy related 4 homolog D (S. cerevisiae) (ATG4D), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATG4D (NM_001281504) Human Tagged ORF Clone
RC238050

USD 420.00

2 Weeks

ATG4D (myc-DDK-tagged) - Human autophagy related 4D, cysteine peptidase (ATG4D), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATG4D (NM_032885) Human Tagged ORF Clone
RG209627

USD 460.00

3 Weeks

ATG4D (GFP-tagged) - Human ATG4 autophagy related 4 homolog D (S. cerevisiae) (ATG4D)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATG4D Rabbit Polyclonal Antibody
TA344179

USD 475.00

5 Days

Rabbit Polyclonal Anti-ATG4D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4D antibody: synthetic peptide directed towards the middle region of human ATG4D. Synthetic peptide located within the following region: AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP
ATG4D (NM_032885) Human Untagged Clone
SC102914

USD 310.00

In Stock

ATG4D (untagged)-Human ATG4 autophagy related 4 homolog D (S. cerevisiae) (ATG4D)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
ATG4D Rabbit Polyclonal Antibody
TA315948

USD 345.00

In Stock

Rabbit polyclonal anti-ATG4D antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ATG4D.
ATG4D (NM_001281504) Human Tagged ORF Clone
RG238050

USD 460.00

2 Weeks

ATG4D (GFP-tagged) - Human autophagy related 4D, cysteine peptidase (ATG4D), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATG4D (NM_032885) Human Untagged Clone
SC317783

USD 760.00

5 Weeks

ATG4D (untagged)-Human ATG4 autophagy related 4 homolog D (S. cerevisiae) (ATG4D)

Vector pCMV6 series
Tag Tag Free
ATG4D (NM_001281504) Human Untagged Clone
SC335944

USD 410.00

2 Weeks

ATG4D (untagged) - Human autophagy related 4D, cysteine peptidase (ATG4D), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATG4D Rabbit Polyclonal Antibody
TA349540

USD 345.00

In Stock

Rabbit Polyclonal Anti-ATG4D Antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ATG4D
ATG4D (NM_032885) ICC Control Block
TB409627

USD 1,070.00

4 Weeks

Transient overexpression of ATG4D (NM_032885) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATG4D (NM_001281504) ICC Control Block
TB438050

USD 1,070.00

4 Weeks

Transient overexpression of ATG4D (NM_001281504) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATG4D Cytosection
TS409627

USD 225.00

4 Weeks

Transient overexpression of ATG4D (NM_032885) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ATG4D Cytosection
TS409627P5

USD 889.00

4 Weeks

Transient overexpression of ATG4D (NM_032885) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ATG4D ICC Control Sections
TS438050P5

USD 889.00

4 Weeks

Transient overexpression of ATG4D (NM_001281504) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack