THOP1 (Myc-DDK-tagged)-Human thimet oligopeptidase 1 (THOP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
THOP1 (Myc-DDK-tagged)-Human thimet oligopeptidase 1 (THOP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
THOP1 (GFP-tagged) - Human thimet oligopeptidase 1 (THOP1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human thimet oligopeptidase 1 (THOP1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human thimet oligopeptidase 1 (THOP1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
6 Weeks
Lenti ORF particles, THOP1 (Myc-DDK tagged) - Human thimet oligopeptidase 1 (THOP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
3 Weeks
Lenti ORF particles, THOP1 (mGFP-tagged) - Human thimet oligopeptidase 1 (THOP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
THOP1 (untagged)-Human thimet oligopeptidase 1 (THOP1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-THOP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THOP1 antibody is: synthetic peptide directed towards the C-terminal region of Human THOP1. Synthetic peptide located within the following region: MDYRSCILRPGGSEDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQV |
THOP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of thimet oligopeptidase 1 (THOP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
(untagged)-Human cDNA FLJ36073 fis, clone TESTI2019697, highly similar to THIMET OLIGOPEPTIDASE (EC 3.4.24.15)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
THOP1 (untagged)-Human thimet oligopeptidase 1 (THOP1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Mouse Monoclonal Antibody against Thimet Oligopeptidase (4D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) THOP1 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
THOP1 MS Standard C13 and N15-labeled recombinant protein (NP_003240)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USD 379.00
In Stock
THOP1 (Thimet Oligopeptidase) mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
THOP1 (Thimet Oligopeptidase) mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
THOP1 (Thimet Oligopeptidase) mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
THOP1 (Thimet Oligopeptidase) mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of THOP1 (NM_003249) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
Tag | C-His |
Expression Host | E. coli |
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
Tag | C-His |
Expression Host | E. coli |
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
Tag | C-His |
Expression Host | E. coli |
Recombinant protein of human thimet oligopeptidase 1 (THOP1)
Tag | C-His |
Expression Host | E. coli |
Transient overexpression of THOP1 (NM_003249) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of THOP1 (NM_003249) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack