Germany
Japan
United Kingdom
China
BCAS2 (Myc-DDK-tagged)-Human breast carcinoma amplified sequence 2 (BCAS2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, BCAS2 (Myc-DDK tagged) - Human breast carcinoma amplified sequence 2 (BCAS2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, BCAS2 (mGFP-tagged) - Human breast carcinoma amplified sequence 2 (BCAS2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
BCAS2 (GFP-tagged) - Human breast carcinoma amplified sequence 2 (BCAS2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human breast carcinoma amplified sequence 2 (BCAS2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BCAS2 (Myc-DDK tagged) - Human breast carcinoma amplified sequence 2 (BCAS2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human breast carcinoma amplified sequence 2 (BCAS2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BCAS2 (mGFP-tagged) - Human breast carcinoma amplified sequence 2 (BCAS2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human breast carcinoma amplified sequence 2 (BCAS2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
BCAS2 (untagged)-Human breast carcinoma amplified sequence 2 (BCAS2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-BCAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCAS2 antibody: synthetic peptide directed towards the middle region of human BCAS2. Synthetic peptide located within the following region: SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
Rabbit Polyclonal Anti-BCAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCAS2 antibody: synthetic peptide directed towards the N terminal of human BCAS2. Synthetic peptide located within the following region: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL |
Lenti ORF clone of Human breast carcinoma amplified sequence 2 (BCAS2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal BCAS2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
BCAS2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of breast carcinoma amplified sequence 2 (BCAS2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-BCAS2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human BCAS2. |
BCAS2 / DAM1 (1-225, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
BCAS2 / DAM1 (1-225, His-tag) human recombinant protein, 10 µg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) BCAS2 mouse monoclonal antibody,clone OTI10H7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BCAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005863)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
BCAS2 mouse monoclonal antibody,clone OTI10H7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BCAS2 mouse monoclonal antibody,clone OTI10H7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BCAS2 mouse monoclonal antibody,clone OTI10H7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BCAS2 mouse monoclonal antibody,clone OTI10H7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of BCAS2 (NM_005872) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2)
| Tag | N-T7&C-His |
| Expression Host | E. coli |
Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2)
| Tag | N-T7&C-His |
| Expression Host | E. coli |
Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2)
| Tag | N-T7&C-His |
| Expression Host | E. coli |
Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2)
| Tag | N-T7&C-His |
| Expression Host | E. coli |
Transient overexpression of BCAS2 (NM_005872) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BCAS2 (NM_005872) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- BCAS2
Pathways
- Spliceosome