DDX5 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
DDX5 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, DDX5 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF particles, DDX5 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
DDX5 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
DDX5 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DDX5 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DDX5 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Goat Polyclonal Antibody against DDX5 / p68 RNA helicase
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PMIGYPMPTGYSQ, from the C Terminus of the protein sequence according to NP_004387.1. |
Rabbit anti-DDX5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DDX5 |
DDX5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
DDX5 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from 306-334 aa at the Center region of human DDX5 |
Rabbit Polyclonal Anti-DDX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5. Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY |
Rabbit Polyclonal Anti-DDX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the N terminal of human DDX5. Synthetic peptide located within the following region: RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY |
DDX5 MS Standard C13 and N15-labeled recombinant protein (NP_004387)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of DDX5 (NM_004396) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DDX5 (NM_004396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DDX5 (NM_004396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack