Products

cDNA Clones (11)
Proteins (7)
Antibodies (5)
Jump to Filters
View as table Download
DDX5 (NM_004396) Human Tagged ORF Clone
RC200371

USD 98.00

USD 560.00

In Stock

DDX5 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DDX5 (NM_004396) Human Tagged ORF Clone Lentiviral Particle
RC200371L2V

USD 1,020.00

2 Weeks

Lenti ORF particles, DDX5 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DDX5 (NM_004396) Human Tagged ORF Clone Lentiviral Particle
RC200371L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, DDX5 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DDX5 (NM_004396) Human Untagged Clone
SC125285

USD 310.00

In Stock

DDX5 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DDX5 (NM_004396) Human Tagged ORF Clone
RG200371

USD 460.00

In Stock

DDX5 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DDX5 (NM_004396) Human Tagged Lenti ORF Clone
RC200371L3

USD 768.00

3 Weeks

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DDX5 (NM_004396) Human Tagged ORF Clone Lentiviral Particle
RC200371L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, DDX5 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DDX5 (NM_004396) Human Tagged Lenti ORF Clone
RC200371L4

USD 768.00

3 Weeks

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DDX5 (NM_004396) Human Tagged ORF Clone Lentiviral Particle
RC200371L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, DDX5 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DDX5 (NM_004396) Human Over-expression Lysate
LY401398

USD 396.00

In Stock

Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DDX5 (NM_004396) Human Tagged Lenti ORF Clone
RC200371L1

USD 768.00

In Stock

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DDX5 Goat Polyclonal Antibody
TA302658

USD 375.00

In Stock

Goat Polyclonal Antibody against DDX5 / p68 RNA helicase

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PMIGYPMPTGYSQ, from the C Terminus of the protein sequence according to NP_004387.1.
DDX5 Rabbit Polyclonal Antibody
TA332589

USD 275.00

3 Weeks

Rabbit anti-DDX5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DDX5
DDX5 (NM_004396) Human Over-expression Lysate
LC401398

USD 121.00

In Stock

DDX5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
DDX5 (NM_004396) Human Tagged Lenti ORF Clone
RC200371L2

USD 768.00

In Stock

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DDX5 Rabbit Polyclonal Antibody
AP17277PU-N

USD 450.00

2 Weeks

DDX5 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from 306-334 aa at the Center region of human DDX5
DDX5 Rabbit Polyclonal Antibody
TA341564

USD 310.00

5 Days

Rabbit Polyclonal Anti-DDX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5. Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY
DDX5 Rabbit Polyclonal Antibody
TA341565

USD 310.00

5 Days

Rabbit Polyclonal Anti-DDX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the N terminal of human DDX5. Synthetic peptide located within the following region: RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY
DDX5 (NM_004396) Human Mass Spec Standard
PH300371

USD 2,055.00

3 Weeks

DDX5 MS Standard C13 and N15-labeled recombinant protein (NP_004387)

Tag C-Myc/DDK
Expression Host HEK293
DDX5 ICC Control Block
TB400371

USD 1,210.00

4 Weeks

Transient overexpression of DDX5 (NM_004396) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DDX5 Cytosection
TS400371

USD 225.00

4 Weeks

Transient overexpression of DDX5 (NM_004396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DDX5 Cytosection
TS400371P5

USD 889.00

4 Weeks

Transient overexpression of DDX5 (NM_004396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack