Germany
Japan
United Kingdom
China
DDX5 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
Lenti ORF particles, DDX5 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, DDX5 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
DDX5 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Ddx5 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDX5 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ddx5 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDX5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN400371 is the updated version of KN200371.
Ddx5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504402 is the updated version of KN304402.
Lenti ORF clone of Ddx5 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx5 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ddx5 (mGFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx5 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DDX5 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DDX5 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ddx5 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ddx5 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx5 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ddx5 (mGFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx5 (GFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ddx5 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ddx5 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
DDX5 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
Rabbit anti-DDX5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DDX5 |
DDX5 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
DDX5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DDX5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ddx5 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
DDX5 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from 306-334 aa at the Center region of human DDX5 |
DDX5 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
3`UTR clone of DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rabbit Polyclonal Anti-DDX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5. Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY |
Rabbit Polyclonal Anti-DDX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the N terminal of human DDX5. Synthetic peptide located within the following region: RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY |
DDX5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
DDX5 CRISPRa kit - CRISPR gene activation of human DEAD-box helicase 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ddx5 CRISPRa kit - CRISPR gene activation of mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene DDX5
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene DDX5
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
DDX5 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
DDX5 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
DDX5 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Ddx5 (untagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Ddx5
Active filters
Target Symbol
- DDX5