Products

View as table Download

USD 98.00

USD 560.00

In Stock

DDX5 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, DDX5 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, DDX5 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

DDX5 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Ddx5 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DDX5 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Ddx5 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DDX5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400371 is the updated version of KN200371.

Ddx5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN504402 is the updated version of KN304402.

Lenti ORF clone of Ddx5 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx5 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Ddx5 (mGFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx5 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DDX5 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DDX5 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Ddx5 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Ddx5 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx5 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Ddx5 (mGFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ddx5 (GFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Ddx5 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Ddx5 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol (34 ug/ml)
Mammalian Cell Selection Puromycin

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

DDX5 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
E. coli Selection Kanamycin
Mammalian Cell Selection Puromycin

Goat Polyclonal Antibody against DDX5 / p68 RNA helicase

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PMIGYPMPTGYSQ, from the C Terminus of the protein sequence according to NP_004387.1.

Rabbit anti-DDX5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DDX5

DDX5 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin

DDX5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

DDX5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Ddx5 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

DDX5 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from 306-334 aa at the Center region of human DDX5

DDX5 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro

3`UTR clone of DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

Rabbit Polyclonal Anti-DDX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5. Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY

Rabbit Polyclonal Anti-DDX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the N terminal of human DDX5. Synthetic peptide located within the following region: RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY

DDX5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

DDX5 CRISPRa kit - CRISPR gene activation of human DEAD-box helicase 5

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Ddx5 CRISPRa kit - CRISPR gene activation of mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene DDX5

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene DDX5

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

DDX5 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA mBFP-Neo

DDX5 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA Luciferase-Puro

DDX5 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA RFP-BSD

Ddx5 (untagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (Ddx5), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Ddx5