HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 1,092.00
5 Weeks
Lenti ORF particles, HSPA8 (Myc-DDK tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, HSPA8 (Myc-DDK tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Rabbit Polyclonal Anti-HSPA8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Lenti ORF particles, HSPA8 (mGFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HSPA8 (mGFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of HSPA8 (mGFP-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HSPA8 (mGFP-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-HSPA8 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of heat shock 70kDa protein 8 (HSPA8), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast |
Conjugation | Unconjugated |
Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPA8 |
Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal HSPA8 antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HSPA8. |
Mouse monoclonal anti-HSPA8(HSC70) antibody, clone 1F2-H5, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat. Not yet tested in other species |
Conjugation | Unconjugated |
Hsc70 (HSPA8) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Porcine, Rat, Sheep |
Immunogen | Synthetic peptide surrounding amino acid 559 of human Hsc70 |
HSPA8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
HSPA8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse Monoclonal anti-HSPA8 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast |
Conjugation | Unconjugated |
Rabbit polyclonal Hsc70 (Hsp73) Antibody
Applications | IF, WB |
Reactivities | Hamster, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Amino acids 618-637 of human hsc70 |
HSPA8 MS Standard C13 and N15-labeled recombinant protein (NP_006588)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
HSPA8 / HSC70 (active) human recombinant protein, 2x0.1 mg
Expression Host | E. coli |
HSPA8 / HSC70 (active) human recombinant protein, 0.1 mg
Expression Host | E. coli |
HSPA8 / HSC70 (active) human recombinant protein, 50 µg
Expression Host | E. coli |
HSPA8 / HSC70 (1-646, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
HSPA8 / HSC70 (1-646, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of heat shock 70kDa protein 8 (HSPA8), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of HSPA8 (NM_006597) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HSPA8 (NM_153201) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HSPA8 (NM_006597) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HSPA8 (NM_006597) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HSPA8 (NM_153201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack