Products

View as table Download

PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti-ORF clone of PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PLRG1 (mGFP-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PLRG1 (mGFP-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PLRG1 (Myc-DDK tagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PLRG1 (GFP-tagged) - Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PLRG1 (GFP-tagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PLRG1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PLRG1 (untagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PLRG1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 16-45 amino acids from the N-terminal region of Human PLRG1

Rabbit Polyclonal Anti-PLRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP

PLRG1 (untagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2

Vector pCMV6 series
Tag Tag Free

USD 1,130.00

4 Weeks

Transient overexpression of PLRG1 (NM_002669) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,130.00

4 Weeks

Transient overexpression of PLRG1 (NM_001201564) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PLRG1 (NM_002669) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PLRG1 (NM_002669) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PLRG1 (NM_001201564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack