PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PLRG1 (mGFP-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLRG1 (mGFP-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLRG1 (Myc-DDK tagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLRG1 (GFP-tagged) - Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLRG1 (GFP-tagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLRG1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of pleiotropic regulator 1 (PRL1 homolog, Arabidopsis) (PLRG1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLRG1 (untagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PLRG1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 16-45 amino acids from the N-terminal region of Human PLRG1 |
Rabbit Polyclonal Anti-PLRG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP |
PLRG1 (untagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of PLRG1 (NM_002669) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLRG1 (NM_001201564) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLRG1 (NM_002669) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLRG1 (NM_002669) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PLRG1 (NM_001201564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack