Products

View as table Download

PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Plrg1 (Myc-DDK-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PLRG1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN410603 is the updated version of KN210603.

Plrg1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513488 is the updated version of KN313488.

Plrg1 (GFP-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Plrg1 (Myc-DDK-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Plrg1 (Myc-DDK-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Plrg1 (mGFP-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Plrg1 (GFP-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PLRG1 (mGFP-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PLRG1 (mGFP-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PLRG1 (Myc-DDK tagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PLRG1 (GFP-tagged) - Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PLRG1 (GFP-tagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Plrg1 (Myc-DDK-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Plrg1 (Myc-DDK-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Plrg1 (Myc-DDK-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Plrg1 (mGFP-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Plrg1 (GFP-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PLRG1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

PLRG1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Plrg1 (untagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

PLRG1 (untagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Goat Polyclonal Antibody against PLRG1

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-PVSWKPEIIKRKRF, from the C Terminus of the protein sequence according to NP_002660.1.

PLRG1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 16-45 amino acids from the N-terminal region of Human PLRG1

Rabbit Polyclonal Anti-PLRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP

PLRG1 CRISPRa kit - CRISPR gene activation of human pleiotropic regulator 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene PLRG1

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene PLRG1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

qPCR primer pairs and template standards against Mus musculus gene Plrg1

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Mus musculus gene Plrg1

Plrg1 (untagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of pleiotropic regulator 1 (PRL1 homolog Arabidopsis) (PLRG1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

PLRG1 (untagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2

Vector pCMV6 series
Tag Tag Free

Plrg1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Plrg1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

PLRG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PLRG1 (NP_001188493.1).
Modifications Unmodified

USD 1,130.00

4 Weeks

Transient overexpression of PLRG1 (NM_002669) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,130.00

4 Weeks

Transient overexpression of PLRG1 (NM_001201564) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PLRG1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

PLRG1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Plrg1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Plrg1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Plrg1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Plrg1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

PLRG1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin

Plrg1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS