PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Plrg1 (Myc-DDK-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLRG1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Plrg1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Plrg1 (GFP-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Plrg1 (Myc-DDK-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Plrg1 (Myc-DDK-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Plrg1 (mGFP-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Plrg1 (GFP-tagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLRG1 (Myc-DDK-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PLRG1 (mGFP-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLRG1 (mGFP-tagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLRG1 (Myc-DDK tagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLRG1 (GFP-tagged) - Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLRG1 (GFP-tagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Plrg1 (Myc-DDK-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Plrg1 (Myc-DDK-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Plrg1 (Myc-DDK-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Plrg1 (mGFP-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Plrg1 (GFP-tagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLRG1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PLRG1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of pleiotropic regulator 1 (PRL1 homolog, Arabidopsis) (PLRG1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Plrg1 (untagged) - Mouse pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PLRG1 (untagged)-Human pleiotropic regulator 1 (PLRG1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Goat Polyclonal Antibody against PLRG1
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PVSWKPEIIKRKRF, from the C Terminus of the protein sequence according to NP_002660.1. |
PLRG1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 16-45 amino acids from the N-terminal region of Human PLRG1 |
Rabbit Polyclonal Anti-PLRG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP |
PLRG1 CRISPRa kit - CRISPR gene activation of human pleiotropic regulator 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PLRG1
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PLRG1
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene Plrg1
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Plrg1
Plrg1 (untagged ORF) - Rat pleiotropic regulator 1, PRL1 homolog (Arabidopsis) (Plrg1), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of pleiotropic regulator 1 (PRL1 homolog Arabidopsis) (PLRG1) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
PLRG1 (untagged) - Homo sapiens pleiotropic regulator 1 (PLRG1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Plrg1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Plrg1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PLRG1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PLRG1 (NP_001188493.1). |
Modifications | Unmodified |
Transient overexpression of PLRG1 (NM_002669) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLRG1 (NM_001201564) in HEK293T cells paraffin embedded controls for ICC/IHC staining
PLRG1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
PLRG1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Plrg1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Plrg1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Plrg1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Plrg1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
PLRG1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
E. coli Selection | Ampicillin |
Mammalian Cell Selection | Puromycin |
Plrg1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |