Products

cDNA Clones (9)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
PRP19 (PRPF19) (NM_014502) Human Tagged ORF Clone
RC200810

USD 420.00

In Stock

PRPF19 (Myc-DDK-tagged)-Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PRP19 (PRPF19) (NM_014502) Human Tagged ORF Clone Lentiviral Particle
RC200810L1V

USD 820.00

3 Weeks

Lenti ORF particles, PRPF19 (Myc-DDK tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PRP19 (PRPF19) (NM_014502) Human Tagged ORF Clone Lentiviral Particle
RC200810L2V

USD 820.00

6 Weeks

Lenti ORF particles, PRPF19 (mGFP-tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PRP19 (PRPF19) (NM_014502) Human Tagged ORF Clone
RG200810

USD 460.00

In Stock

PRPF19 (GFP-tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PRP19 (PRPF19) (NM_014502) Human Tagged ORF Clone Lentiviral Particle
RC200810L3V

USD 820.00

5 Weeks

Lenti ORF particles, PRPF19 (Myc-DDK tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PRP19 (PRPF19) (NM_014502) Human Tagged ORF Clone Lentiviral Particle
RC200810L4V

USD 820.00

3 Weeks

Lenti ORF particles, PRPF19 (mGFP-tagged) - Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PRP19 (PRPF19) (NM_014502) Human Untagged Clone
SC319066

USD 310.00

In Stock

PRPF19 (untagged)-Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PRP19 (PRPF19) (NM_014502) Human Tagged ORF Clone
RC200810L1

USD 768.00

In Stock

Lenti ORF clone of Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PRP19 (PRPF19) (C-term) Guinea Pig Polyclonal Antibody
AP09537SU-N

USD 395.00

2 Weeks

PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH
PRP19 (PRPF19) (NM_014502) Human Tagged ORF Clone
RC200810L2

USD 620.00

3 Weeks

Lenti ORF clone of Human PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PRP19 (PRPF19) Rabbit Polyclonal Antibody
TA329843

USD 310.00

5 Days

Rabbit Polyclonal Anti-PRPF19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK
PRP19 (PRPF19) (NM_014502) Human Over-expression Lysate
LC402343

USD 121.00

In Stock

PRPF19 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PRP19 (PRPF19) Rabbit Polyclonal Antibody
TA329842

USD 310.00

5 Days

Rabbit Polyclonal Anti-PRPF19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the N terminal of human PRPF19. Synthetic peptide located within the following region: VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP
PRP19 (PRPF19) (NM_014502) Human Over-expression Lysate
LY402343

USD 396.00

5 Days

Transient overexpression lysate of PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) (PRPF19)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PRP19 (PRPF19) (NM_014502) Human Mass Spec Standard
PH300810

USD 2,055.00

3 Weeks

PRPF19 MS Standard C13 and N15-labeled recombinant protein (NP_055317)

Tag C-Myc/DDK
Expression Host HEK293
PRP19 (PRPF19) (NM_014502) ICC Control Block
TB400810

USD 1,070.00

4 Weeks

Transient overexpression of PRPF19 (NM_014502) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PRP19 (PRPF19) Cytosection
TS400810

USD 225.00

4 Weeks

Transient overexpression of PRPF19 (NM_014502) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PRP19 (PRPF19) Cytosection
TS400810P5

USD 889.00

4 Weeks

Transient overexpression of PRPF19 (NM_014502) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack