Products

cDNA Clones (12)
Proteins (7)
Antibodies (5)
Jump to Filters
View as table Download
SF3B3 (NM_012426) Human Tagged ORF Clone
RC209509

USD 1,280.00

In Stock

SF3B3 (Myc-DDK-tagged)-Human splicing factor 3b, subunit 3, 130kDa (SF3B3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SF3B3 (NM_012426) Human Tagged ORF Clone Lentiviral Particle
RC209509L1V

USD 1,680.00

3 Weeks

Lenti ORF particles, SF3B3 (Myc-DDK tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SF3B3 (NM_012426) Human Tagged ORF Clone Lentiviral Particle
RC209509L2V

USD 1,680.00

6 Weeks

Lenti ORF particles, SF3B3 (mGFP-tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SF3B3 (NM_012426) Human Tagged ORF Clone
RG209509

USD 1,410.00

In Stock

SF3B3 (GFP-tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SF3B3 (NM_012426) Human Tagged ORF Clone
RC209509L3

USD 1,480.00

3 Weeks

Lenti ORF clone of Human splicing factor 3b, subunit 3, 130kDa (SF3B3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF3B3 (NM_012426) Human Tagged ORF Clone Lentiviral Particle
RC209509L3V

USD 1,680.00

5 Weeks

Lenti ORF particles, SF3B3 (Myc-DDK tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF3B3 (NM_012426) Human Tagged ORF Clone
RC209509L4

USD 1,480.00

3 Weeks

Lenti ORF clone of Human splicing factor 3b, subunit 3, 130kDa (SF3B3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF3B3 (NM_012426) Human Tagged ORF Clone Lentiviral Particle
RC209509L4V

USD 1,680.00

7 Weeks

Lenti ORF particles, SF3B3 (mGFP-tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF3B3 (NM_012426) Human Tagged ORF Clone
RC209509L1

USD 1,836.00

In Stock

Lenti ORF clone of Human splicing factor 3b, subunit 3, 130kDa (SF3B3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SF3B3 (NM_012426) Human Untagged Clone
SC126731

USD 310.00

In Stock

SF3B3 (untagged)-Human splicing factor 3b, subunit 3, 130kDa (SF3B3)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SF3B3 (NM_012426) Human Untagged Clone
SC323872

USD 310.00

In Stock

SF3B3 (untagged)-Human splicing factor 3b, subunit 3, 130kDa (SF3B3)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SF3B3 Rabbit Polyclonal Antibody
TA343784

USD 475.00

5 Days

Rabbit Polyclonal Anti-SF3B3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B3 antibody: synthetic peptide directed towards the middle region of human SF3B3. Synthetic peptide located within the following region: TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI
SF3B3 Rabbit Polyclonal Antibody
TA343785

USD 475.00

5 Days

Rabbit Polyclonal Anti-SF3B3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B3 antibody: synthetic peptide directed towards the middle region of human SF3B3. Synthetic peptide located within the following region: EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
SF3B3 (NM_012426) Human Tagged ORF Clone
RC209509L2

USD 1,480.00

3 Weeks

Lenti ORF clone of Human splicing factor 3b, subunit 3, 130kDa (SF3B3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SF3B3 Rabbit Polyclonal Antibody
TA308399

USD 415.00

5 Days

Rabbit polyclonal antibody to SAP130 (splicing factor 3b, subunit 3, 130kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1154 and 1217 of SAP130 (Uniprot ID#Q15393)
SF3B3 (NM_012426) Human Over-expression Lysate
LC415767

USD 121.00

In Stock

SF3B3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SF3B3 (NM_012426) Human Over-expression Lysate
LY415767

USD 396.00

5 Days

Transient overexpression lysate of splicing factor 3b, subunit 3, 130kDa (SF3B3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SF3B3 (C-term) Rabbit Polyclonal Antibody
AP53870PU-N

USD 450.00

2 Weeks

SF3B3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1053-1082 amino acids from the C-terminal region of Human SF3B3.
SF3B3 Goat Polyclonal Antibody
TA302598

USD 375.00

5 Days

Goat Polyclonal Antibody against SAP130 / SF3B3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VSKKLEDIRTRYAF, from the C Terminus of the protein sequence according to NP_036558.3.
SF3B3 (NM_012426) Human Mass Spec Standard
PH309509

USD 2,055.00

3 Weeks

SF3B3 MS Standard C13 and N15-labeled recombinant protein (NP_036558)

Tag C-Myc/DDK
Expression Host HEK293
SF3B3 (NM_012426) ICC Control Block
TB409509

USD 1,930.00

4 Weeks

Transient overexpression of SF3B3 (NM_012426) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SF3B3 Cytosection
TS409509

USD 225.00

4 Weeks

Transient overexpression of SF3B3 (NM_012426) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SF3B3 Cytosection
TS409509P5

USD 889.00

4 Weeks

Transient overexpression of SF3B3 (NM_012426) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack