Germany
Japan
United Kingdom
China
Recombinant protein of human splicing factor 3b, subunit 3, 130kDa (SF3B3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Products
View as table Download
SF3B3 (Myc-DDK-tagged)-Human splicing factor 3b, subunit 3, 130kDa (SF3B3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SF3B3 (Myc-DDK tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SF3B3 (mGFP-tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Sf3b3 (Myc-DDK-tagged) - Mouse splicing factor 3b, subunit 3 (Sf3b3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SF3B3 (GFP-tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SF3B3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409509 is the updated version of KN209509.
Sf3b3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN515644 is the updated version of KN315644.
Sf3b3 (GFP-tagged) - Mouse splicing factor 3b, subunit 3 (Sf3b3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Sf3b3 (Myc-DDK-tagged) - Mouse splicing factor 3b, subunit 3 (Sf3b3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sf3b3 (Myc-DDK-tagged) - Mouse splicing factor 3b, subunit 3 (Sf3b3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Sf3b3 (mGFP-tagged) - Mouse splicing factor 3b, subunit 3 (Sf3b3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sf3b3 (GFP-tagged) - Mouse splicing factor 3b, subunit 3 (Sf3b3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human splicing factor 3b, subunit 3, 130kDa (SF3B3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SF3B3 (Myc-DDK tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human splicing factor 3b, subunit 3, 130kDa (SF3B3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SF3B3 (mGFP-tagged) - Human splicing factor 3b, subunit 3, 130kDa (SF3B3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Sf3b3 (Myc-DDK-tagged ORF) - Rat splicing factor 3b, subunit 3 (Sf3b3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human splicing factor 3b, subunit 3, 130kDa (SF3B3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
SF3B3 (untagged)-Human splicing factor 3b, subunit 3, 130kDa (SF3B3)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SF3B3 (untagged)-Human splicing factor 3b, subunit 3, 130kDa (SF3B3)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-SF3B3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SF3B3 antibody: synthetic peptide directed towards the middle region of human SF3B3. Synthetic peptide located within the following region: TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI |
Rabbit Polyclonal Anti-SF3B3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SF3B3 antibody: synthetic peptide directed towards the middle region of human SF3B3. Synthetic peptide located within the following region: EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT |
Lenti ORF clone of Human splicing factor 3b, subunit 3, 130kDa (SF3B3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SF3B3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SF3B3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of splicing factor 3b, subunit 3, 130kDa (SF3B3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Sf3b3 (untagged) - Mouse splicing factor 3b, subunit 3 (Sf3b3), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SF3B3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1053-1082 amino acids from the C-terminal region of Human SF3B3. |
qSTAR qPCR primer pairs against Mus musculus gene Sf3b3
Goat Polyclonal Antibody against SAP130 / SF3B3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VSKKLEDIRTRYAF, from the C Terminus of the protein sequence according to NP_036558.3. |
SF3B3 CRISPRa kit - CRISPR gene activation of human splicing factor 3b subunit 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Sf3b3 CRISPRa kit - CRISPR gene activation of mouse splicing factor 3b, subunit 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SF3B3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene SF3B3
qPCR primer pairs and template standards against Mus musculus gene Sf3b3
| Application | Plasmid of exact quantity for transcript copy number calculation |
SF3B3 MS Standard C13 and N15-labeled recombinant protein (NP_036558)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Sf3b3 (untagged ORF) - Rat splicing factor 3b, subunit 3 (Sf3b3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Sf3b3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
SF3B3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SF3B3 |
SF3B3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SF3B3 |
SF3B3/SAP130 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 948-1217 of human SF3B3/SAP130 (NP_036558.3). |
| Modifications | Unmodified |
Transient overexpression of SF3B3 (NM_012426) in HEK293T cells paraffin embedded controls for ICC/IHC staining
SF3B3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
SF3B3 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Sf3b3 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Sf3b3 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- SF3B3