Products

Proteins (13)
cDNA Clones (10)
Antibodies (6)
Jump to Filters
View as table Download
Inhibin beta A (INHBA) (NM_002192) Human Untagged Clone
SC319183

USD 310.00

In Stock

INHBA (untagged)-Human inhibin, beta A (INHBA)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Inhibin beta A (INHBA) (NM_002192) Human Tagged ORF Clone
RG203226

USD 460.00

In Stock

INHBA (GFP-tagged) - Human inhibin, beta A (INHBA)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Inhibin beta A (INHBA) Rabbit Polyclonal Antibody
TA349355

USD 380.00

In Stock

Rabbit Polyclonal Anti-INHBA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human INHBA
Inhibin beta A (INHBA) Rabbit Polyclonal Antibody
TA308909

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A
Inhibin beta A (INHBA) (N-term) Rabbit Polyclonal Antibody
AP52211PU-N

USD 450.00

2 Weeks

Inhibin beta A (INHBA) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen This INHBA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-112 amino acids from the N-terminal region of human INHBA.
Inhibin beta A (INHBA) (NM_002192) Human Tagged ORF Clone
RC203226L1

USD 620.00

In Stock

Lenti ORF clone of Human inhibin, beta A (INHBA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Inhibin beta A (INHBA) Rabbit Polyclonal Antibody
TA332948

USD 275.00

3 Weeks

Rabbit anti-INHBA Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human INHBA
Inhibin beta A (INHBA) (NM_002192) Human Recombinant Protein
TP723003

USD 240.00

5 Days

Purified recombinant protein of Human inhibin, beta A (INHBA).

Tag Tag Free
Expression Host E. coli
Inhibin beta A (INHBA) (NM_002192) Human Recombinant Protein
TP723875

USD 265.00

5 Days

Purified recombinant protein of Human inhibin, beta A (INHBA)

Tag Tag Free
Expression Host CHO
Inhibin beta A (INHBA) (NM_002192) Human Over-expression Lysate
LC400796

USD 121.00

In Stock

INHBA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Inhibin beta A (INHBA) (NM_002192) Human Over-expression Lysate
LY400796

USD 396.00

5 Days

Transient overexpression lysate of inhibin, beta A (INHBA)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Inhibin beta A (INHBA) Rabbit Polyclonal Antibody
TA335048

USD 375.00

5 Days

Rabbit Polyclonal Anti-INHBA Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-INHBA antibody: synthetic peptide directed towards the N terminal of human INHBA. Synthetic peptide located within the following region: CPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALL
Inhibin beta A chain (INHBA) Human Protein
AR05248PU-S

USD 590.00

5 Days

Inhibin beta A chain (INHBA) human recombinant protein, 10 µg

Inhibin beta A chain (INHBA) (311-426, His-tag) Human Protein
AR51799PU-N

USD 845.00

2 Weeks

Inhibin beta A chain (INHBA) (311-426, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Inhibin beta A chain (INHBA) (311-426, His-tag) Human Protein
AR51799PU-S

USD 330.00

2 Weeks

Inhibin beta A chain (INHBA) (311-426, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Inhibin beta A (INHBA) (NM_002192) Human Mass Spec Standard
PH303226

USD 2,055.00

3 Weeks

INHBA MS Standard C13 and N15-labeled recombinant protein (NP_002183)

Tag C-Myc/DDK
Expression Host HEK293
Inhibin beta A (INHBA) Rabbit Polyclonal Antibody
TA321447

USD 345.00

4 Weeks

Anti-INHBA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 375-390 amino acids of Human Inhibin beta A chain
Inhibin beta A (INHBA) ICC Control Block
TB403226

USD 1,070.00

4 Weeks

Transient overexpression of INHBA (NM_002192) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Inhibin beta A (INHBA) (NM_002192) Human Recombinant Protein
TP762679

USD 261.00

2 Weeks

Purified recombinant protein of Human inhibin, beta A (INHBA), 259Lys-End, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
Inhibin beta A (INHBA) Cytosection
TS403226

USD 225.00

4 Weeks

Transient overexpression of INHBA (NM_002192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Inhibin beta A (INHBA) Cytosection
TS403226P5

USD 889.00

4 Weeks

Transient overexpression of INHBA (NM_002192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack