Germany
Japan
United Kingdom
China
PPP2CA (Myc-DDK-tagged)-Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PPP2CA (untagged)-Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC321401 is the updated version of SC127984.
USD 820.00
3 Weeks
Lenti ORF particles, PPP2CA (Myc-DDK tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PPP2CA (mGFP-tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PPP2CA (GFP-tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PPP2CA (Myc-DDK tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PPP2CA (mGFP-tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP2CA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PP2A-alpha (PPP2CA) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | The purified peptide conjugated to KLH. |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | The immunogen is the purified peptide conjugated to KLH. |
Goat Polyclonal Antibody against PPP2CA / PPP2CB
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EPHVTRRTPDYFL, from the C Terminus of the protein sequence according to NP_002706.1; NP_004147.1. |
Rabbit Polyclonal Anti-PPP2CA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI |
PPP2CA MS Standard C13 and N15-labeled recombinant protein (NP_002706)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-PPP2CA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PPP2CA |
Transient overexpression of PPP2CA (NM_002715) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP2CA (NM_002715) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP2CA (NM_002715) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PPP2CA
Pathways
- Tight junction