Germany
Japan
United Kingdom
China
PPP2CA (Myc-DDK-tagged)-Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PPP2CA (untagged)-Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC321401 is the updated version of SC127984.
Ppp2ca (Myc-DDK-tagged) - Mouse protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, PPP2CA (Myc-DDK tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PPP2CA (mGFP-tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PPP2CA (GFP-tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Ppp2ca (GFP-tagged) - Mouse protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ppp2ca - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513765 is the updated version of KN313765.
Lenti ORF clone of Ppp2ca (Myc-DDK-tagged) - Mouse protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2ca (Myc-DDK-tagged) - Mouse protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp2ca (mGFP-tagged) - Mouse protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PPP2CA (Myc-DDK tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PPP2CA (mGFP-tagged) - Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ppp2ca (Myc-DDK-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppp2ca (Myc-DDK-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2ca (Myc-DDK-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp2ca (mGFP-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2ca (GFP-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP2CA (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Ppp2ca (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
PPP2CA - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Ppp2ca (GFP-tagged) - Mouse protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP2CA - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PPP2CA - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 2, catalytic subunit, alpha isozyme (PPP2CA), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
3`UTR clone of protein phosphatase 2 (formerly 2A) catalytic subunit alpha isoform (PPP2CA) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Ppp2ca - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Ppp2ca - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP2CA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PP2A-alpha (PPP2CA) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | The purified peptide conjugated to KLH. |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | The immunogen is the purified peptide conjugated to KLH. |
qSTAR qPCR primer pairs against Homo sapiens gene PPP2CA
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Goat Polyclonal Antibody against PPP2CA / PPP2CB
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EPHVTRRTPDYFL, from the C Terminus of the protein sequence according to NP_002706.1; NP_004147.1. |
Rabbit Polyclonal Anti-PPP2CA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI |
Ppp2ca - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
PPP2CA CRISPRa kit - CRISPR gene activation of human protein phosphatase 2 catalytic subunit alpha
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ppp2ca CRISPRa kit - CRISPR gene activation of mouse protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PPP2CA
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene PPP2CA
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Ppp2ca
PPP2CA MS Standard C13 and N15-labeled recombinant protein (NP_002706)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ppp2ca (untagged ORF) - Rat protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (Ppp2ca), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Ppp2ca (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- PPP2CA