Germany
Japan
United Kingdom
China
TBK1 (Myc-DDK-tagged)-Human TANK-binding kinase 1 (TBK1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
TBK1 (untagged)-Human TANK-binding kinase 1 (TBK1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human TANK-binding kinase 1 (TBK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
TBK1 (GFP-tagged) - Human TANK-binding kinase 1 (TBK1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, TBK1 (Myc-DDK tagged) - Human TANK-binding kinase 1 (TBK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TBK1 (mGFP-tagged) - Human TANK-binding kinase 1 (TBK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human TANK-binding kinase 1 (TBK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TBK1 (Myc-DDK tagged) - Human TANK-binding kinase 1 (TBK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TANK-binding kinase 1 (TBK1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TBK1 (mGFP-tagged) - Human TANK-binding kinase 1 (TBK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of TANK-binding kinase 1 (TBK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TBK1 (untagged)-Kinase deficient mutant (K38M) of Human TANK-binding kinase 1 (TBK1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human TANK-binding kinase 1 (TBK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Mouse Monoclonal NAK Antibody (108A429)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine |
| Conjugation | Unconjugated |
TA336453 is a replacement of AM08296PU-N.
Lenti ORF clone of Human TANK-binding kinase 1 (TBK1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TBK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TBK1 |
TBK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
(untagged)-Homo sapiens, clone MGC:16389 IMAGE:3938647, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal NAK Antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | NAK antibody was raised against a synthetic peptide corresponding to 17 amino acids form near the carboxy terminus of human NAK/TBK1. |
Goat Polyclonal TBK1 (aa514-527) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TIETSLQDIDSRLS, from the C or N Terminus of the protein sequence according to NP_037386.1 |
Rabbit Polyclonal Anti-TBK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the N terminal of human TBK1. Synthetic peptide located within the following region: EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM |
Rabbit Polyclonal Anti-TBK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the middle region of human TBK1. Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ |
TBK1 MS Standard C13 and N15-labeled recombinant protein (NP_037386)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of TBK1 (NM_013254) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TBK1 (NM_013254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TBK1 (NM_013254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TBK1
Pathways
- Toll-like receptor signaling pathway