Germany
Japan
United Kingdom
China
TBK1 (Myc-DDK-tagged)-Human TANK-binding kinase 1 (TBK1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
TBK1 (untagged)-Human TANK-binding kinase 1 (TBK1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human TANK-binding kinase 1 (TBK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Tbk1 (Myc-DDK-tagged) - Mouse TANK-binding kinase 1 (Tbk1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TBK1 (GFP-tagged) - Human TANK-binding kinase 1 (TBK1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, TBK1 (Myc-DDK tagged) - Human TANK-binding kinase 1 (TBK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TBK1 (mGFP-tagged) - Human TANK-binding kinase 1 (TBK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TBK1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405238 is the updated version of KN205238.
Tbk1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN517271 is the updated version of KN317271.
Tbk1 (GFP-tagged) - Mouse TANK-binding kinase 1 (Tbk1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Tbk1 (Myc-DDK-tagged) - Mouse TANK-binding kinase 1 (Tbk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tbk1 (mGFP-tagged) - Mouse TANK-binding kinase 1 (Tbk1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human TANK-binding kinase 1 (TBK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TBK1 (Myc-DDK tagged) - Human TANK-binding kinase 1 (TBK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TANK-binding kinase 1 (TBK1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TBK1 (mGFP-tagged) - Human TANK-binding kinase 1 (TBK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tbk1 (Myc-DDK-tagged ORF) - Rat TANK-binding kinase 1 (Tbk1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tbk1 (Myc-DDK-tagged ORF) - Rat TANK-binding kinase 1 (Tbk1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tbk1 (Myc-DDK-tagged ORF) - Rat TANK-binding kinase 1 (Tbk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tbk1 (mGFP-tagged ORF) - Rat TANK-binding kinase 1 (Tbk1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tbk1 (GFP-tagged ORF) - Rat TANK-binding kinase 1 (Tbk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tbk1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
Tbk1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Transient overexpression lysate of TANK-binding kinase 1 (TBK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
TBK1 (untagged)-Kinase deficient mutant (K38M) of Human TANK-binding kinase 1 (TBK1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, Tbk1 (GFP-tagged) - Mouse TANK-binding kinase 1 (Tbk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TANK-binding kinase 1 (TBK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TBK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Mouse Monoclonal NAK Antibody (108A429)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine |
| Conjugation | Unconjugated |
TA336453 is a replacement of AM08296PU-N.
Lenti ORF clone of Human TANK-binding kinase 1 (TBK1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TBK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TBK1 |
TBK1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
TBK1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
TBK1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
TBK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Homo sapiens gene TBK1
(untagged)-Homo sapiens, clone MGC:16389 IMAGE:3938647, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
qSTAR qPCR primer pairs against Mus musculus gene Tbk1
Rabbit Polyclonal NAK Antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | NAK antibody was raised against a synthetic peptide corresponding to 17 amino acids form near the carboxy terminus of human NAK/TBK1. |
Goat Polyclonal TBK1 (aa514-527) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TIETSLQDIDSRLS, from the C or N Terminus of the protein sequence according to NP_037386.1 |
Rabbit Polyclonal Anti-TBK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the N terminal of human TBK1. Synthetic peptide located within the following region: EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM |
Rabbit Polyclonal Anti-TBK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the middle region of human TBK1. Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ |
TBK1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
TBK1 CRISPRa kit - CRISPR gene activation of human TANK binding kinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Tbk1 CRISPRa kit - CRISPR gene activation of mouse TANK-binding kinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene TBK1
| Application | Plasmid of exact quantity for transcript copy number calculation |
Tbk1 (untagged) - Mouse TANK-binding kinase 1 (Tbk1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Tbk1 (Myc-DDK-tagged) - Mouse TANK-binding kinase 1 (Tbk1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
TBK1 MS Standard C13 and N15-labeled recombinant protein (NP_037386)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Tbk1 (untagged ORF) - Rat TANK-binding kinase 1 (Tbk1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- TBK1