Germany
Japan
United Kingdom
China
ICA1 (Myc-DDK-tagged)-Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ICA1 (Myc-DDK-tagged)-Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
ICA1 (Myc-DDK-tagged)-Human islet cell autoantigen 1, 69kDa (ICA1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, ICA1 (Myc-DDK tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ICA1 (mGFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ICA1 (GFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ICA1 (GFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ICA1 (Myc-DDK tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ICA1 (mGFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ICA1 (Myc-DDK tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ICA1 (mGFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ICA1 (Myc-DDK tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ICA1 (mGFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ICA1 (Myc-DDK tagged) - Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ICA1 (GFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ICA1 (GFP-tagged) - Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ICA1 (untagged)-Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ICA1 (untagged)-Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ICA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ICA1 antibody: synthetic peptide directed towards the N terminal of human ICA1. Synthetic peptide located within the following region: SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS |
ICA1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 83-111 amino acids from the N-terminal region of human Islet cell autoantigen 1 / ICA1 |
Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-ICA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ICA1 antibody: synthetic peptide directed towards the C terminal of human ICA1. Synthetic peptide located within the following region: NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA |
ICA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ICA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ICA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_004959)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ICA1 MS Standard C13 and N15-labeled recombinant protein (NP_001129492)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ICA1 (untagged)-Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ICA1 (untagged)-Human islet cell autoantigen 1, 69kDa (ICA1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ICA1 (untagged) - Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of ICA1 (NM_004968) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ICA1 (NM_022307) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ICA1 (NM_001136020) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ICA1 (NM_001276478) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ICA1 (NM_004968) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ICA1 (NM_004968) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ICA1 (NM_022307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ICA1 (NM_022307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ICA1 (NM_001136020) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- ICA1
Pathways
- Type I diabetes mellitus